HOMMAN KESKUSTELU => Mylly => Aiheen aloitti: slobovorsk - 17.09.2011, 13:44:58

Otsikko: EU:n yhteinen pakolaispolitiikka (CEAS)... missä mennään???
Kirjoitti: slobovorsk - 17.09.2011, 13:44:58
Laitetaanpas uusi ketju tänne Kylänraitille, kun aiheeseen liittyvä keskustelu on ollut tyrehtyneenä ja hajonneena pitkin Hommaa. Kuten Hattiwatti toisaalla sanoi, tämä aihe liittyy erittäinkin paljon myös käsittelyssä olevaan perustuslain muutosesitykseen.

Todellinen helvetti repeää irti siitä, kun astuu voimaan EU:n yhteinen taakanjakosopimus. Välimeri on rikastunut täyteen mamua, mikä osasyy myös talouskriisiin (kun kaikki talous pyörii etnisellä työvoimalla, ei tule veroja valtion kassaan). Nyt sitä taakkaa haluttaisiin tänne rikkaampaan pohjolaankin jaettavaksi. En kerro enempää, koska aihetta on käsitelty ihan tarpeeksi.
Kiitos Hattiwatti muistutuksesta!  Itse pelkään 20000 humanitaarisen maahanmuuttajan vuodessa olevan vasta alkua. Maahanmuutto repeää suomalaisten käsistä viimeistään siinä vaiheessa kun Suomesta on tullut EU:n osavaltio, jollooin suomalaiset eivät enää saa määrätä keitä täällä asuu. Minusta nimenomaan tätä elintärkeää asiaa ei viime aikoina ole pidetty tarpeeksi esillä oikein missään. Mitä nyt ohjaaja Aki Bambimäki sanoi männäviikolla pitävänsä nykytilannetta epäreiluna Etelä-Euroopan kannalta.

Hiljaisuus alkaa huolestuttaa eli missähän tällä hetkellä mennään?

Ainakaan kevätpuolella EU:n yhteistä pakolaispolitiikkaa ei vielä oltu hyväksytty. EU:n oikeus- ja sisäministerit hyväksyivät loppukeväästä joitakin muita direktiivejä aiheeseen liittyen. Muun muassa sellaisen, että yhdessä EU-maassa viisi vuotta laillisella oleskeluluvalla asunut humanitaarinen maahanmuuttaja saisi muuttaa toiseen EU-maahan, ja olisi saman tien oikeutettu uuden kotimaansa sosiaaliturvaan. Näin taakanjako toteutuisi keittiön kautta viiveellä jo hyväksytyilläkin säännöillä.

Muistutettakoon, että Suomen uusi hallitus sitoutui ohjelmassaan nimenomaan sen edistämiseen, että EU:n yhteinen pakolaispolitiikka taakanjakoineen tulisi voimaan jo 2012. Toivottavasti muut maat (kuten Tanska ja Britannia, jotka jättäytyneet ennestään ulkopuolelle) ovat järkevämpiä, ettei tämä esitys oikeasti mene läpi EU:ssa. Seuraava oikeus- ja sisäministerien kokous on syyskuun aikana.

Asiasta oli Hommassa monta ketjua kevätpuolella, pitänee alkaa kaivella esiin.

Linkkejä Homman sisällä:

Huhtikuulta 2011:

http://hommaforum.org/index.php/topic,48419.0.html

Maaliskuulta 2011:

http://hommaforum.org/index.php/topic,44638.0.html

En valitettavasti löydä sitä aikaisempaa, aihetta käsittelleistä ketjuista parasta, joka alkoi vuonna 2010, mutta taitavammat varmaan löytävät. Toivoisin tästä EU:n yhteisestä turvapaikkapolitiikasta kestoaihetta, jonka löytäisi Hommasta helpommin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 17.09.2011, 14:07:48
Linkkisi otsikoilla:
2011-03-10: YLE 1: EU:n yhteinen pakolaispolitiikka jo 2012 (http://hommaforum.org/index.php/topic,44638.0.html)
2011-04-24 YLE: EU:n maahanmuuttopolitiikan yhtenäistämiseen kovat paineet (http://hommaforum.org/index.php/topic,48419.0.html)

Ovat kieltämättä monessa ketjussa. Muun muassa tällaisia löytyy:
2010-03-03 Europarlamentti: Yhteinen turvapaikkapolitiikka ja taakanjako (http://hommaforum.org/index.php/topic,27433.0.html)

EU-suunnitelma pakolaisten maakiintiöistä etenee, pakolaisille äänioikeus  (http://hommaforum.org/index.php/topic,6076.0.html)
2011-05-25 EU: Pohjois-Afrikkaan miljardien tuet ja viisumivapaus (http://hommaforum.org/index.php/topic,50636.0.html)
2011-03-26 Yhteisvastuu EU:n turvapaikanhakijoista jakaa puolueita (http://hommaforum.org/index.php/topic,46212.0.html)
2010-07-13 EU-ministerikokouksen aiheena yhteinen turvapaikkajärjestelmä (http://hommaforum.org/index.php/topic,31222.0.html)
Eurooppanuoret: Erittäin Julkista - Euroopan tulevaisuuden julkinen lisäpöytäkirja (http://hommaforum.org/index.php/topic,42910.0.html)
2009-12-10 EU: Tukholman ohjelma Eurooppa-neuvoston hyväksyttäväksi huomenna  (http://hommaforum.org/index.php/topic,19143.0.html)
2010-07-16 AL: Suomalaiset haluavat EU:lle yhteisen maahanmuuttopolitiikan (http://hommaforum.org/index.php/topic,31391.0.html)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 17.09.2011, 16:38:37
Kiitos, Roope, löytyiväthän ne sieltä!

Hiljaista siis on, mutta pinnan alla asiaa ilmeisesti valmistellaan. Muistelin, että Pravdassa luki kesäkuun lopulla jotain EU:n uuden turvapaikkaviraston johtajan lobbauskäynnistä Helsingissä. Joku uuden hallituksen kukkahatuista, kenties Hautala oli käynyt keskusteluja, ja asioiden kerrottiin etenevän ...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RTT - 17.09.2011, 18:10:40
Kesällä uutisoitiin (http://euobserver.com/22/32406) että neuvottelut yhteisestä tuvapaikkapolitiikasta jumiutuivat, koska Dublin-sopimuksen muuttamisesta ei päästy yksimielisyyteen. Komissio halusi itselleen oikeuden kieltää kaikki Dublin-palautukset maahan, johon todetaan kohdistuvan "poikkeuksellista painetta", kuten Kreikka. Jäsenmaiden enemmistön mielestä tälläinen järjestelmä palkitsisi huonosta turvapaikanhakijoiden kohtelusta. En usko, että muitakaan muutosehdotuksia otettiin riemumielin vastaan.

Suurimpana esteenä lienee Saksa, joka on edelleen avoimen kielteinen EU:n suunnitelmiin. Päivi Räsänen taas alkoi ministeriksi päästyään jostain syystä kannattamaan yhteistä turvapaikkapolitiikkaa, vaikka KD nimenomaisesti vastusti sitä viime eurovaaliohjelmassaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Reich - 17.09.2011, 18:22:08
Päivi Räsänen taas alkoi ministeriksi päästyään jostain syystä kannattamaan yhteistä turvapaikkapolitiikkaa, vaikka KD nimenomaisesti vastusti sitä viime eurovaaliohjelmassaan.

Yhteisen turvapaikkapolitiikan sisältö on olennaista. Räsänen voi saada aikaan vaikka kuinka hyvän sopimuksen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: TheJ - 17.09.2011, 18:57:08
Muistelisin että Homman oma EU-agentti Sampo Terho lupaili jossain vaiheessa kaivaa tuosta lisää tietoa EU-parlamentin näkövinkkelistä käsin. Onkohan mitään kuulunut? Tosin itse olen ainakin toistaiseksi skeptinen tuon materialisoitumiseen koska..

- Saksa vastustaa
- Kreikka ja potentiaalisesti Italia ovat jo muutenkin natisemassa liitoksistaan rikastumisensa kanssa enkä olisi hirveän järkyttynyt jos taloustilanteen vielä heikentyessä alkaa yllättäen ilmeistymään työvoiman vapaan liikkumisen esteitä EU-maiden välille - myös ihan kansalaisille, ainakin noissa maissa, puhumattakaan sitten (laittomista) siirtolaisista.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 17.09.2011, 19:06:58
Yhteisen turvapaikkapolitiikan sisältö on olennaista. Räsänen voi saada aikaan vaikka kuinka hyvän sopimuksen.

Sopimus voisi olla aluksi vaikka kuinka hyvä. Olennaista on turvapaikkapolitiikan päätösvallan siirtäminen pois Suomen eduskunnalta. Valta ei tulisi enää takaisin, vaikka sopimusta myöhemmin muutettaisiin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 17.09.2011, 22:47:11
Yhteisen turvapaikkapolitiikan sisältö on olennaista. Räsänen voi saada aikaan vaikka kuinka hyvän sopimuksen.

Sopimus voisi olla aluksi vaikka kuinka hyvä. Olennaista on turvapaikkapolitiikan päätösvallan siirtäminen pois Suomen eduskunnalta. Valta ei tulisi enää takaisin, vaikka sopimusta myöhemmin muutettaisiin.

Tuota noin. Miten tämän nyt muotoilisi. En halua mollata Päivi Räsäsen ammattitaitoa, mutta hänen maahanmuuttopoliittiset kannanottonsa ovat viime aikoina olleet aika ristiriitaisia. Entä jos Räsänen ei ole tutustunut aiheeseen riittävästi? Yhteinen turvapaikkapolitiikka ja taakanjako voi hänen mielestään kuulostaa äkkiseltään hyvältä ratkaisulta.

En minä tiedä, miten Räsänen tuntee asiaa ja miten hän hoitaa hommansa. Tuli vaan mieleen. Ehkä kannaottojen ristiriitaisuus hämää minua. Siitä uskallan kuitenkin olla aika varma, että humanitaariseen maahanmuuttoon Päivi suhtautuu nuivasti, vaikka hän kristittynä ehkä asetteleekin sanansa tarkoin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 18.09.2011, 16:32:34
Kiitos kommenteista ja vastauksista tähän asti!

Ehkä on tosiaan niin, että: "No news is good news" tässäkin asiassa. Eikä CEASin läpimeno tosiaankaan olisi kirkossa kuulutettu, vaikka Suomi sitä ajaisikin. Muissa maissa ei kenties olla niin hulluja, niin kuin parista kommentista sai jo lukea. Sitä paitsi huomio lienee EU:ssakin jo kääntynyt ainakin joksikin aikaa toisaalle arabikevään ja Libyan sodan rauhoittuessa ja Kreikka- ym. finanssikriisien takia. Kunhan ei pääse vahingossa takaovesta ...

Uskon Räsäsen toimivan tässä asiassa paljon paremmin kuin edeltäjänsä Thors/Brax/Holmlund, kenties Essayahin vaikutuksesta. Uudesta oikeusministeri Henrikssonista en kyllä ole varma, ja veikkaan hänen ja Räsäsen osallistuvan EU-kokouksiin jotenkin vuorotellen edeltäjiensä tapaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.09.2011, 17:21:05
Viivytyksiä on tullut niin paljon, että on vaikea uskoa suunnitelmien menevän läpi ainakaan alkuperäisessä muodossaan. Mutta kun päättämässä ovat edelleen Malmströmin kaltaiset kahjot, niin heillä on varmasti jo jotain muuta työn alla. Kannattaa olla hyvin varuillaan esimerkiksi kolmansien maiden kumppanuusohjelmien ja viisumihelpotusten suhteen. Turkki kiristää paraikaa itselleen viisumivapautta laittomien siirtolaisen palautussopimuksen vastineeksi. EU on kaappaamassa jäsenmaiden erilliset kiintiöpakolaisohjelmat ja laajentaa niitä satojen miljoonien eurojen tukipaketeilla moninkertaisiksi.

Pahinta on kuitenkin epätietoisuus. Etukäteen tärkeiksi arvelluista neuvotteluista ei välttämättä tihku jälkikäteen mitään tietoa. Suomen ajamia kantoja EU:n maahanmuuttokysymyksiin ei kerrota missään. Edes Suomen sisäisistä ministeriöiden linjauksista ei tiedetä kuin ympäripyöreitä yhteenvetoja.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 11.10.2011, 18:54:22
Seuraavaa oikeus- ja sisäministerien neuvoston kokousta odotellessa (ei ainakaan lähimpien parin viikon sisään) syyskuisen kokouksen tuloksia englanniksi, turvapaikkasysteemistä puhutaan sivulla 8.

Syyskuisen kokouksen lehdistötiedote (se sama kokous, jossa Päivi Räsänen ja Hollanti estivät Romanian ja Bulgarian Schengen-jäsenyyden)

http://www.consilium.europa.eu/ueDocs/cms_Data/docs/pressData/en/jha/124713.pdf

Dublin-asetuksen muuttamisesta puhuttu, mutta se on ollut jumissa. Enemmistö maista on sentään vastustanut muutosta, jossa palauttaminen muualta EU:sta takaisin turvapaikanhakijoiden tulvasta kärsivään maahan kiellettäisiin väliaikaisesti. Yhteiseen turvapaikkapolitiikkaan vuonna 2012 ollaan edelleen sitoutuneita ja sitä viedään eteenpäin... Uutena ideana tuotiin esiin ennakoivan arviointimekanismin kehittely.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 28.11.2011, 16:06:42
Muistaessani päivittelen tätä. Uutta kerrottavaa ei ainakaan minulla ainakaan vielä. Ehkä jollakulla?

Vilkaisin EU:n sivuille, linkki:

http://consilium.europa.eu/media/1315836/december_jha.pdf

EU:ssa näköjään tämän mukaan seuraava sisä/oikeusministerikokous 13. - 14. joulukuuta. EU:n turvapaikka-asiaa on linkissä näkyvien kokousaikataulujen mukaan valmisteltu lukuisissa kokouksissa ainakin nyt marraskuussa, ja kokoukset jatkuvat joulukuussa aivan ministerikokousten aluspäiviin.

Jos tulkitsen oikein, vaikuttaa siltä että pyrkimys saada aikaan ministerineuvoston päätös asiasta vielä tänä vuonna on kova. Toivon olevani väärässä... 
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 13.12.2011, 15:22:59
Kivaa, sain ketjun omakseni...

Vilkaisin EU:n sivuille, ainkaan eilen sisäministerien kokouksen asialistalla ei näyttänyt olevan kuin CEAS-asioiden tilannekatsaus. Huomenna varmaan viisaampia, ehkä vielä tänään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: normi - 13.12.2011, 15:24:47
Mikä ihmeen vimma on tuhota eruooppaa ja mahdollisimman nopeasti?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 06.01.2012, 13:58:15
Lainaus
"Puuttuu poliittista tahtoa"

EU-komissaari taistelee verisesti saadakseen läpi yhteiset säännöt pakolaisten vastaanottoon ja työperäiseen maahanmuuttoon koko EU:n alueella. Mutta finanssikriisi, kasvava työttömyys ja lisääntyvä muukalaisvihamielisyys koko Euroopassa tekevät hänen tehtävästään vaikean.

[...]

- USA ottaa alueelta [Pohjois-Afrikasta] vastaan enemmän pakolaisia kuin EU, se on noloa. Ja nämä maat ovat meidän omia naapureitamme, sanoi Cecilia Malmströn lehdistötilaisuudessa syksyllä.

[...]

Välimeren yli matkanneita tunisialaisia - joista suurin osa etsi töitä, ei turvapaikkaa - oli vaivaiset 25 000, vaikka esimerkiksi Italiassa oli puhetta "raamatullisten mittasuhteiden" massamaahanmuutosta. Puolitoista miljoonaa ihmistä voi vallata Italian, varoitti sisäministeri Roberto Maroni helmikuun lopulla, kun pohjoisafrikkalaisten kansannousu oli tuskin alkanutkaan.

Pian tämän jälkeen syntyi kiista Ranskan ja Italian välille 5000 ranskankielisestä tunisialaisesta, joille Italia antoi viisumin koko EU:n alueelle. He tulevat kaikki Ranskaan, sanoi Ranskan hallitus ja sulki rajansa.

Alarmistinen asenne näin pienen maahanmuuttajajoukon saapumisesta viittaa työhön, jota Cecilia Malmström ilman kiitoksia hoitaa Brysselissä: maahanmuuttoasioihin.

Ennen vuoden loppua hänen on saatava EU:n hallitukset hyväksymään yhteiset turvapaikkasäännöt, näin on tarkoitus, ja mielellään myös yhteiset säännöt työvoiman muuttoon. Kolmessa vuodessa toteutetaan koko ns. Tukholman ohjelma, EU:n viisivuotisstrategia muun muassa maahanmuutto- ja rajapolitiikasta.

[...]

Jokaisella osa-alueella EU-komissaari joutuu vastustamaan EU-maiden yhä kovaäänisempiä maahanmuuttovihamielisiä puolueita ja mielipiteitä. Yksittäiset hallitukset haluavat pitää kiinni oikeudesta rajoittaa maahanmuuttoa oman tahtonsa mukaan, ja finanssikriisin aikaan ne haluavat näyttää kansalaisilleen, että ne pitävät ulkomaiset työntekijät ja pakolaiset ulkona.

Yksinkertaisia faktoja:
- Tomaatin- ja appelsiininpoimintaan Etelä-Euroopassa, marjanpoimintaan Ruotsissa ja muihin kausitöihin tarvitaan satojatuhansia ulkomaisia työntekijöitä joka vuosi.
- On työnantajien syytä, että he maksavat puolustuskyvyttömille maahanmuuttajille liian pientä palkkaa ja näin dumppaavat palkkoja - ei maahanmuuttajien syy.
- Maahanmuuttajat täyttävät jo ammottavia aukkoja hyvinvoinnissa.

- Tiedämme esimerkiksi, että espanjalainen vanhustenhuolto romahtaisi, jos laittomasti työskentelevät eteläamerikkalaiset yhtäkkiä katoaisivat. Meillä on kaikki tieto, se ei ole ongelma. Ongelma on täydellinen poliittisen tahdon puute jäsenmaissa, sanoi Malmström Brysselissä aamiaisella, kun hän oli EU:n maahanmuuttopolitiikasta raportin jättäneen ajatuspaja Global utmaningin vieraana.

Maahanmuuttotutkija Lisa Pelling, yksi raportin kirjoittajista, on sitä mieltä, että painavin argumentti säädellyn ja tehokkaan koko EU:n työmaahanmuuton tärkeyttä painottavalle on se, että työtilanne ei ole nollasummapeliä.

- Kun maahanmuuttaja saa työpaikan, se ei tarkoita, että joku eurooppalainen menettää sen. Käy katsomassa lähimmässä terveyskeskuksessa, kuinka monta maahanmuuttajalääkäriä siellä on nykyään. Ajattele kuinka monta uutta maahanmuuttajalääkäriä tarvitaan muutaman vuoden päästä, kuin entisiä on vähemmän, sanoo tutkija.

[...]

Cecilia Malmströmin on nopeasti löydettävä oikea sävy ja taktiikka neuvotteluihin 27 jäsenmaan kanssa, jos aikataulusta aiotaan pitää kiinni.


Infolaatikko:
Näistä asioista [Tukholman ohjelmassa] maahanmuutto- turvapaikkakysymykset ovat selvästi kuumimmat poliittisesti. Useat Etelä-Euroopan maat kuten Malta, Espanja ja Italia ovat vaatineet apua pohjoisilta EU-mailta Välimeren ja Kanariansaarten maahanmuuttovirtoihin, mutta pohjoiset maat väittävät, että ne ovat jo saaneet osuutensa saapuneista, ja että pakolaisten lähettäminen EU:n reuna-alueilta mantereelle vain houkuttelisi lisää pakolaisia, koska juuri sitä he haluavatkin.

(käännös)
SvD: ”Politisk vilja saknas”  (http://www.svd.se/nyheter/utrikes/politisk-vilja-saknas_6748211.svd)4.1.2012

edit:
Tässä kyseinen Ruotsin oikeusministeriön ja Global utmaning -ajatuspajan raportti EU:n maahanmuuttopolitiikasta. Käsittelee lähinnä työperäistä maahanmuuttoa, mutta siinä sivutaan myös esimerkiksi Suomessa ja muissa maissa nousseita "äärioikeistolaisia" puolueita.

Moving Beyond Demographics – perspectives for a common European migration policy (http://en.globalutmaning.se/?p=2744)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: kohmelo - 11.01.2012, 09:42:45
Tanskan EU-puheenjohtajuuskauden yksi tärkeistä prioriteeteistä on EU:n yhteinen turvapaikkapolitiikka.

http://ansamed.ansa.it/ansamed/en/news/nations/europe/2012/01/09/visualizza_new.html_42267937.html
Lainaus
Immigration: asylum policy by 2012, EU presidency
Top priority of Danish presidency in first semester

(ANSAmed) - BRUSSELS, 9 JANUARY - Harmonising asylum policies in the 27 EU Member States and promoting solidarity at the EU level on immigration issues by 2012: these are the objectives of the European common asylum system, among the top priorities of the new Danish EU presidency. Copenhagen explicitly stated this in its first semester programme: "the Danish presidency shall try to advance negotiations and laws on the asylum package as much as possible". Denmark's aim is to honour the Member States' commitment and "finalize the European common asylum system by the end of 2012". The Danish presidency will also continue working to prevent and fight illegal immigration, strengthen the Schengen system and improve effectiveness of control on the EU's external borders. Visa and repatriation policies, according to the current EU's Danish presidency , "shall be the key-elements of a well-managed asylum and immigration policy, fully respecting human dignity". (ANSAmed).
 
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 12.01.2012, 02:04:17
Tanskan EU-puheenjohtajuuskauden yksi tärkeistä prioriteeteistä on EU:n yhteinen turvapaikkapolitiikka.

YK:n pakolaisjärjestö UNHCR:n terveiset puheenjohtajamaa Tanskalle avaavat tarkemmin, millaisia muutoksia EU:n turvapaikkapolitiikalta tänä vuonna odotetaan. Ainakin paljon solidaarisuutta, sillä solidaarisuus mainitaan tekstissä parikymmentä kertaa.

UNHCR’s Recommendations to Denmark for its EU Presidency (http://www.unhcr.org/refworld/pdfid/4f02fcb92.pdf) (pdf)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: berethiel - 06.02.2012, 10:34:21
Nyt kun Saulista tuli presidentti, niin kokoomuksella alkaa olemaan pullat hyvin uunissa. Katainenhan kaipaili tänne jo pari vuotta sitten yli miljoonaa maahanmuuttajaa ja Sauli varmasti on samalla kannala, kun on kerran EU mieskin
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lemmy - 06.02.2012, 12:31:15
Jos kaikissa EU-maissa olisi yhtäläiset sosiaaliturvakäytännöt, mutta kun ei ole, niin sosiaaliturvapaikanhakijoita tulee riittämään. Tervemenoa pohjoismainen hyvinvointivaltio.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 08.02.2012, 22:03:50
Lainaus
Symposium - Towards a Common European Asylum System - Improving Protection, Solidarity and Harmonisation 21.3.2012 Bryssel

In recent years, the EU has been receiving an average of 1.8 million immigrants annually and as such, immigration has become a key issue in the national politics of many Member States.

The Common European Asylum System (CEAS), which was reinforced by The Hague Programme (November 2004) and The Stockholm Programme (2009), is currently in its second phase, with the Cypriot Presidency hoping to finalise the System by the end of 2012.

This timely International Symposium will explore the ongoing challenges that Europe is facing to increase the practical cooperation between member states, especially in relation to the collection of measurable data on asylum seekers.

For further details about the Symposium, please refer to the enclosed event brochure. Do feel free to circulate this information to relevant colleagues within your organisation.

In the meantime, to ensure your organisation is represented, please complete and return the registration form at your earliest convenience in order to secure your delegate place(s).

 

Information Flyer (http://www.emn.fi/files/546/Flyer.pdf)

Registration (http://www.emn.fi/files/547/Registration.doc)

Euroopan muuttoliikeverkosto (http://www.emn.fi/ajankohtaista/symposium_-_towards_a_common_european_asylum_system_-_improving_protection_solidarity_and_harmonisation_21.3.2012_bryssel.html)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: pneuma - 15.02.2012, 18:57:22
Uskoisin tämän ilahduttavan ja rauhoittavan hommalaisia. Lyhyesti sanottuna neuvottelut yhteisestä pakolaispolitiikasta ovat pahasti jumissa kun toisaalta talouskriisi, toisaalta keskustaoikeiston aseman vahvistuminen on saanut jäsenvaltiot panemaan entistä kovemmin hanttiin. Seuraavassa otteita EU-asioiden erikoislehden European Voicen viimeviikkoisesta artikkelista "Protecting member states or the rights of asylum-seekers?" (http://www.europeanvoice.com/article/imported/protecting-member-states-or-the-rights-of-asylum-seekers-/73519.aspx) (tosin vain osa luettavissa ilman kirjautumista):

Lainaus käyttäjältä: European Voice, 9.2.2012
The Common European Asylum System is supposed to be in place by the end of this year, according to a pledge made by the EU's member states in 2008 and repeatedly reaffirmed since then.

But that pledge has become “a running joke”, says Claude Moraes, a UK centre-left MEP who follows asylum matters. “I don't know why anyone is taking it seriously.” There is a “political drag” from the member states on the asylum system because, according to Moraes, “every single” member state but Denmark is centre-right. “In the middle of an economic crisis they don't want to make progress on such a sensitive subject.”

Lainaus käyttäjältä: European Voice, 9.2.2012
Core elements of the new system, in addition to the European Asylum Support Office in Malta, are revisions to the Dublin II regulation and two new directives – on how an applicant's asylum status is to be determined, and on how asylum-seekers are to be treated while waiting for the outcome of that process. Both directives are completely deadlocked in talks between the member states: the reception conditions directive still has more than 120 objections or reservations by member states.

Samassa artikkelissa mainitaan sekin, että vaikka (EU:n sisäasioista vastaava komissaari) Cecilia Malmström yritti kovasti saada Dublin II-asetukseen lausekkeen, jonka nojalla turvapaikanhakijoiden palautukset maihin, joilla on vaikeuksia huolehtia heistä, voitaisiin keskeyttää koko EU:n alueella, jäsenvaltioiden vastarinnan (vain 11 kannatti muutosta) vuoksi hän joutui myöntämään tappionsa viime kuussa.

Turvapaikanhakijoiden ns. taakanjaon järjestämiselle on ollut jotakuinkin nykyistä vastaavat oikeudelliset edellytykset jo vuodesta 2004 lähtien (siis jo kauan ennen Lissabonin sopimuksen voimaanastumista, ks. varsinkin silloisten EU-sopimusten artikla 63.2b), mutta eihän siitä mitään tule, kun todellista poliittista tahtoa ei löydy lähimainkaan juhlapuheita vastaavaa määrää (kuten niin usein EU:ssa).

Eli tilanne on ja pysyy samana kuin tähänkin asti: pahin uhka Homman tavoitteille ei ole Euroopan unioni, vaan ihan vaan kotimaiset mokuttajat...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 15.02.2012, 19:01:05
Kiitos pneuma, tulin iloiseksi!  :D
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.02.2012, 20:01:11
Eli tilanne on ja pysyy samana kuin tähänkin asti: pahin uhka Homman tavoitteille ei ole Euroopan unioni, vaan ihan vaan kotimaiset mokuttajat...

Pahin uhka ovat kotimaiset poliitikot, jotka haluavat luovuttaa maahanmuuttopoliittista päätöksentekovaltaa Euroopan unionille, ettei asiasta tulisi sisäpoliittista kysymystä. Vaikka tämän vuoden aiotussa aikataulussa ei Malmströmin kauhistukseksi pysytäkään, niin monet asiat etenevät siitä huolimatta: pakolaisrahastot, EASO:n vahvistuminen, kiintiöpakolaisten vastaanoton keskittäminen jne.

Nykyisin Suomi on pakolaisjärjestöjen ja Etelä-Euroopan maiden ohella EU:n yhteisen turvapaikkapaikkapolitiikan suurimpia kannattajia, ja pyrkii aina peesaamaan Ruotsia. Suomen olisi aika antaa aivan toisenlainen viesti EU:hun päin, mutta oikeastaan muuta ei ole tapahtunut, kuin että Thors on vaihdettu pois.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Siili - 15.02.2012, 20:17:28
Suomen olisi aika antaa aivan toisenlainen viesti EU:hun päin, mutta oikeastaan muuta ei ole tapahtunut, kuin että Thors on vaihdettu pois.

Kyllä se on mielestäni jotain.  Thors oli mamutuksen suhteen ilmeisen aloitteellinen, kun taas Räsänen vaikuttaa hallitusohjelmaa nuivemmalta.   
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: pneuma - 15.02.2012, 20:29:46
Eli tilanne on ja pysyy samana kuin tähänkin asti: pahin uhka Homman tavoitteille ei ole Euroopan unioni, vaan ihan vaan kotimaiset mokuttajat...

Pahin uhka ovat kotimaiset poliitikot, jotka haluavat luovuttaa maahanmuuttopoliittista päätöksentekovaltaa Euroopan unionille, ettei asiasta tulisi sisäpoliittista kysymystä. Vaikka tämän vuoden aiotussa aikataulussa ei Malmströmin kauhistukseksi pysytäkään, niin monet asiat etenevät siitä huolimatta: pakolaisrahastot, EASO:n vahvistuminen, kiintiöpakolaisten vastaanoton keskittäminen jne.

Sitähän ne jotkut kovasti yrittävät, mutta tuo strategia ei vaan käytännössä toimi, koska suurin osa muista jäsenmaista ei ole halukas tekemään samaa, eikä se siksi voi myöskään muodostaa sitä pahinta uhkaa. EASO:kin näyttää jäävän lähinnä jäsenmaita (mm. turvapaikkahakemusten käsittelemisessä tai käsittelyn järjestämisessä) avustavaksi sekä tietoa päätöksenteon pohjaksi kerääväksi ja analysoivaksi organisaatioksi. Samasta artikkelista:

Lainaus käyttäjältä: European Voice, 9.2.2012
[EASO:n pääjohtaja Robert] Visser, previously the director-general for international and immigration affairs in the Dutch ministry of justice, is adamant that EASO will support the member states and not chip away at their competences in asylum procedures. “In the end, it's always the individual decision that counts,” he says, “and the individual decision is not with EASO, it remains with the member states.”
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kuvio - 15.02.2012, 20:30:38
Jos kaikissa EU-maissa olisi yhtäläiset sosiaaliturvakäytännöt, mutta kun ei ole, niin sosiaaliturvapaikanhakijoita tulee riittämään. Tervemenoa pohjoismainen hyvinvointivaltio.
Päättäkööt pohjoismaat itse meneekö vaiko ei, Suomessa sellaista ei kuitenkaan ole koskaan ollut mikäli sitä tarkoitit.
Joillain erityisryhmillä on ollut sellainen ja joissain pienissä kunnissa kaikilla asukkailla. Ei kuitenkaan kannata yleistää koko Suomea koskemaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.02.2012, 20:52:02
Kyllä se on mielestäni jotain.  Thors oli mamutuksen suhteen ilmeisen aloitteellinen, kun taas Räsänen vaikuttaa hallitusohjelmaa nuivemmalta.   

Thors ei ollut lainsäädännössä enää vuoden 2009 alun ulkomaalaislain uudistuksen jälkeen aloitteellinen, vaan pyrki lähinnä jarruttamaan ja vesittämään tiukennuksia, joihin muu hallitus vaalien lähestyessä häntä painosti.

Räsänen on ehdottanut tiukennuksia, mutta vastapainoksi myös lievennyksiä. Mitään erityisiä omia tiukennuksia hän ei ole muistaakseni ehdottanut, vaan esimerkiksi perheenyhdistämislain tiukennukset pantiin alulle hallintovaliokunnassa vuosi sitten. Räsänen täsmensi, että Suomen perheenyhdistämisiä linjataan tänä vuonna muiden Pohjoismaiden suuntaan, vaikka ei ole yhtä pohjoismaista linjaa. Tanskalla on hyvin erilainen politiikka kuin Ruotsilla. Oikea vertailukohta lainsäädäntötyössä pitäisi olla Keski-Eurooppa (tai sitten koko EU), koska sieltä turvapaikanhakijat saapuvat.

Räsänen ei ole kaudellaan avannut Suomen maahanmuuttopoliittista linjausta EU:n suhteen millään tavalla. Tästä voisi päätellä, että linja on pysynyt entisellään. Yksityiskohdista ei ole tietoa, mutta tiedämme, että Suomi kannattaa edelleen EU:n yhteistä turvapaikkapolitiikkaa.

Sitähän ne jotkut kovasti yrittävät, mutta tuo strategia ei vaan käytännössä toimi, koska suurin osa muista jäsenmaista ei ole halukas tekemään samaa, eikä se siksi voi myöskään muodostaa sitä pahinta uhkaa. EASO:kin näyttää jäävän lähinnä jäsenmaita (mm. turvapaikkahakemusten käsittelemisessä tai käsittelyn järjestämisessä) avustavaksi sekä tietoa päätöksenteon pohjaksi kerääväksi ja analysoivaksi organisaatioksi.

EASO:n kanssa päästiin vasta viime vuonna alkuun. Totta kai sitä nimitetään tässä vaiheessa "avustavaksi ja tietoja kerääväksi" organisaatioksi. Tavoite on tehdä siitä pitkällä tähtäimellä hakemukset käsittelevä ja kaikkea EU:n pakolaistoimintaa (turvapaikanhakijat, kiintiöpakolaiset) koordinoiva organisaatio.

Kaikenlaista tapahtuu itse CEAS:in kehittämisen ulkopuolellakin, vaikka yhteinen järjestelmä ei näennäisesti etenisikään. EU-byrokratiakoneiston rakentamista testataan nyt ensin kiintiöpakolaisilla, heidän vastaanottonsa rahoittavilla rahastoilla ja rahanjakomalleilla. Esimerkiksi Dublin-käännytykset Kreikkaan ja monilta osin myös Italiaan on jo Malmströmin tavoitteiden mukaisesti lopetettu, vaikka itse Dublin-sopimusta ei saatukaan neuvoteltua uusiksi.

Mitään ei ole peruttu, linjaa ei ole muutettu. Saksan ja muutaman muun maan vastahanka muutamissa yhteisen turvapaikkajärjestelmän kysymyksissä ei estä sitä, että monilla muilla alueilla liutaan koko ajan huonompaan suuntaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: pneuma - 15.02.2012, 21:05:30
Roope: mokuttajilla, kuten Malmströmillä on tietysti suuria toiveita CEAS:n, EASO:n ym. roolista, mutta on sitten kokonaan toinen juttu, kannattaako niitä pitää realistisina tulevaisuudenskenaarioina...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.02.2012, 21:21:18
Roope: mokuttajilla, kuten Malmströmillä on tietysti suuria toiveita CEAS:n, EASO:n ym. roolista, mutta on sitten kokonaan toinen juttu, kannattaako niitä pitää realistisina tulevaisuudenskenaarioina...

Ne nyt kuitenkin etenevät koko ajan aivan riippumatta siitä, mitä mieltä niistä olemme tai vastustavatko tietyt maat periaatteessa tiettyjä hankkeita. EASO on nyt, vaikka ei ollut vielä pari vuotta sitten. CEAS ei ole nyt, mutta on parin vuoden päästä. Ei vielä lopullisessa muodossaan, mutta on kuitenkin koko ajan kasvavana byrokratiana.

EU:n pakolaisrahastoista on tulossa miljardeja euroja levitettäväksi pakolaisten vastaanottajille. Kun on tarpeeksi rahaa, rakennetaan infra ja ostetaan halutun poliitikan ajajat. Tämä pohjatyö vie vuosia, mutta se etenee tasaisen varmasti.

EU on nyt suunnilleen siinä tilanteessa, missä Suomi oli ennen ensimmäisiä vastaanottokeskuksia. Lisää siihen paljon rahaa, uusia edunsaajia ja parikymmentä vuotta, niin ollaan nykyisessä tilanteessa, jossa vastaanottokeskuksia ei enää pysty aluepoliittisista syistä vastalauseitta lakkauttamaan, vaikka koko vastaanottobisnes on vahingollista tai ainakin erittäin huonosti perusteltu tapa polttaa rahaa ja tuhlata resursseja.

Pelkällä jarruttelulla tätä taistelua ei voiteta. On aika pian käännettävä kelkka kokonaan toiseen suuntaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: pneuma - 15.02.2012, 23:01:03
Roope: mokuttajilla, kuten Malmströmillä on tietysti suuria toiveita CEAS:n, EASO:n ym. roolista, mutta on sitten kokonaan toinen juttu, kannattaako niitä pitää realistisina tulevaisuudenskenaarioina...

Ne nyt kuitenkin etenevät koko ajan aivan riippumatta siitä, mitä mieltä niistä olemme tai vastustavatko tietyt maat periaatteessa tiettyjä hankkeita. EASO on nyt, vaikka ei ollut vielä pari vuotta sitten. CEAS ei ole nyt, mutta on parin vuoden päästä. Ei vielä lopullisessa muodossaan, mutta on kuitenkin koko ajan kasvavana byrokratiana.

Eivät todellakaan etene riippumatta ministerineuvoston kannasta, joka käy hyvin ilmi linkkaamastani artikkelista. EASO:lla voi olla sen verran monenlaista järkevääkin toimintaa (tiedonhankinta, tehokkaiden käytäntöjen levittäminen, vaikeuksissa olevien jäsenmaiden auttaminen paikan päällä), että tuskinpa on niin, että jo sen syntymistä voisi pitää merkkinä jostakin paljon pitemmälle menevien, synkkien suunnitelmien voittokulusta. Ja esimerkiksi Kreikkaan tehtävien Dublin-käännytysten lopettaminen ei kuvasta mitään EU:n sisäistä pyrkimystä aina vain syvempään maahanmuuttopoliittiseen integraatioon: EU paremminkin seurasi täysin EU-rakenteiden ulkopuolisen elimen eli Euroopan ihmisoikeustuomioistuimen tulkintaa (http://euobserver.com/22/31681), että Dublin-käännytykset Kreikkaan loukkaavat EU-lainsäädännöstä riippumatonta Euroopan ihmisoikeussopimusta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.02.2012, 02:46:47
Eivät todellakaan etene riippumatta ministerineuvoston kannasta, joka käy hyvin ilmi linkkaamastani artikkelista.

Kuten sanottu, on monenlaista näennäisesti CEAS:in ulkopuolista toimintaa, joka etenee kaiken aikaa. Esimerkiksi pakolaisrahastot, joista maksetaan rahaa (aluksi) kiintiöpakolaisia EU:n kautta vastaanottaville maille.

Lainaus
EASO:lla voi olla sen verran monenlaista järkevääkin toimintaa (tiedonhankinta, tehokkaiden käytäntöjen levittäminen, vaikeuksissa olevien jäsenmaiden auttaminen paikan päällä), että tuskinpa on niin, että jo sen syntymistä voisi pitää merkkinä jostakin paljon pitemmälle menevien, synkkien suunnitelmien voittokulusta.

Eipä tuollaista organisaatiota koskaan ennen tarvittu, vaikka turvapaikanhakijoiden määrä on tällä hetkellä Euroopassa historiallisesti varsin matalalla tasolla. Tietoa on kerätty ja jaettu ja jäsenmaita neuvottu ennenkin. EASO:n perustaminen ja laajentaminen on täysin linjassa pitkän aikavälin tavoitteiden eli turvapaikkajärjestelmän keskittämisen (yhteiset kriteerit, yhteinen käsittely) kanssa. Keskittämistä ei voisi tapahtua ilman EASO:n kaltaista organisaatiota. Nyt se on pantu alkuun.

Lainaus
Ja esimerkiksi Kreikkaan tehtävien Dublin-käännytysten lopettaminen ei kuvasta mitään EU:n sisäistä pyrkimystä aina vain syvempään maahanmuuttopoliittiseen integraatioon: EU paremminkin seurasi täysin EU-rakenteiden ulkopuolisen elimen eli Euroopan ihmisoikeustuomioistuimentulkintaa (http://euobserver.com/22/31681), että Dublin-käännytykset Kreikkaan loukkaavat EU-lainsäädännöstä riippumatonta Euroopan ihmisoikeussopimusta.

Vaikea tuosta on sanoa taustoja tuntematta, kuin että päätös tuli melkoisen sopivaan kohtaan maailmanhistoriassa. Kreikassa tuskin on muuttunut yksittäisen turvapaikanhakijan kannalta juuri mikään pitkiin aikoihin, mutta ihmisoikeussopimuksen tiukempi tulkinta astui voimaan juuri, kun Dublin-sopimus piti ottaa neuvoteltavaksi.

edit:
Luulin uudelleensijoitussopimusten olevan jo voimassa, mutta eivät vielä olekaan:
Lainaus
Back in September 2009, the EU announced the “Joint EU Resettlement Programme (JEURP)” – an initiative to co-ordinate and resource EU states to grow resettlement in Europe.  Unfortunately, since its announcement JEURP has been blocked in a tussle between MEPs in parliament and those in the EU Commission.  Despite this, the mood of Tuesday’s conference was upbeat.  Tavares leads a pretty determined lot, and it was apparent that these former problems are finally being overcome and that JEURP is gaining new momentum. It’s a much needed development, as European resettlement numbers are shameful.
Refugees in the EU: Resettlement Awareness Day 2012 (http://blog.refugee-action.org/2012/02/refugees-in-the-eu-resettlement-awareness-day-2012/) 10.2.2012

Lainaus
We have adopted the long term residence directive, as well as the qualification direction and are very close to an agreement on the European Resettlement Program.
Cecilia Malmström (http://blogs.ec.europa.eu/malmstrom/two-years-have-gone%e2%80%a6/) 8.2.2012

Malmströmin kehuma UNHCR:n Antonio Guterresin puheenvuoro:
Remarks by António Guterres (http://www.unhcr.se/fileadmin/user_upload/PDFdocuments/2012_News/120127-HC-JHA-DK.pdf) 26.1.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 04.03.2012, 23:46:10
Lainaus
Negotiations on the Asylum Package

Today I’ve spent most of the time dealing with asylum related issues. In the morning I had a meeting in the Parliament with the responsible Rapporteurs and the chief negotiator for the Danish Presidency, on the different parts in the Asylum package. The aim was to update each other on the situation and see how we can proceed. Especially with the Dublin Regulation and the Reception Conditions Directive things are moving forward and possible compromises are being chiselled out while the list of “difficult issues to resolve” becomes shorter. There is still a lot of work to be done but hopefully the formal negotiations on these two directives will take place at the end of the month.

The Asylum Procedures Directive is trickier and will take longer, but even here it is now moving forward. While we sat in the meeting today we received a report form the Committee next door who had just voted in favour of the proposal for a Joint European Resettlement Program. This is a proposal that the Commission put forward in 2009 and the last weeks there have been intense negotiations on this proposal. All the issues are now solved and the Council will take a formal decision next week and the Parliament will vote in two weeks time. This means that together with the UNHCR we will be able to pool our resources in a better and more strategic way. In this way, we can perhaps help to empty a refugee camp somewhere in the world and provide better support for refugees. The program is voluntary, but I hope that most Member States eventually will join.
Cecilia Malmström (http://blogs.ec.europa.eu/malmstrom/negotiations-on-the-asylum-package/) 1.3.2012

Neuvottelut yhteisestä turvapaikkajärjestelmästä etenevät. Yhteinen kiintiöpakolaisjärjestelmä kokonaisten pakolaisleirien tyhjentämiseksi Eurooppaan on enää europarlamentin hyväksyntää vailla.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 05.03.2012, 02:13:26
Lainaus
Negotiations on the Asylum Package

Today I’ve spent most of the time dealing with asylum related issues. In the morning I had a meeting in the Parliament with the responsible Rapporteurs and the chief negotiator for the Danish Presidency, on the different parts in the Asylum package. The aim was to update each other on the situation and see how we can proceed. Especially with the Dublin Regulation and the Reception Conditions Directive things are moving forward and possible compromises are being chiselled out while the list of “difficult issues to resolve” becomes shorter. There is still a lot of work to be done but hopefully the formal negotiations on these two directives will take place at the end of the month.

The Asylum Procedures Directive is trickier and will take longer, but even here it is now moving forward. While we sat in the meeting today we received a report form the Committee next door who had just voted in favour of the proposal for a Joint European Resettlement Program. This is a proposal that the Commission put forward in 2009 and the last weeks there have been intense negotiations on this proposal. All the issues are now solved and the Council will take a formal decision next week and the Parliament will vote in two weeks time. This means that together with the UNHCR we will be able to pool our resources in a better and more strategic way. In this way, we can perhaps help to empty a refugee camp somewhere in the world and provide better support for refugees. The program is voluntary, but I hope that most Member States eventually will join.
Cecilia Malmström (http://blogs.ec.europa.eu/malmstrom/negotiations-on-the-asylum-package/) 1.3.2012

Neuvottelut yhteisestä turvapaikkajärjestelmästä etenevät. Yhteinen kiintiöpakolaisjärjestelmä kokonaisten pakolaisleirien tyhjentämiseksi Eurooppaan on enää europarlamentin hyväksyntää vailla.

Miten tuo järjestelmä tulee vaikuttamaan Suomeen? Jutussa ilmeisesti sanotaan, että ko. järjestelmä on vapaaehtoinen, mutta ei taida olla epäilystäkään, etteikö Suomi tuohon ottaisi osaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.03.2012, 10:24:18
Miten tuo järjestelmä tulee vaikuttamaan Suomeen? Jutussa ilmeisesti sanotaan, että ko. järjestelmä on vapaaehtoinen, mutta ei taida olla epäilystäkään, etteikö Suomi tuohon ottaisi osaa.

Kiintiöpakolaisten vastaanoton järjestäminen keskitetään EU-elimelle. Suomi ei enää itse valikoisi kiintiöpakolaisia haluamiensa kriteerien mukaan haluamistaan maista, vaan päätökset tekee EU. Näistä kiintiöpakolaisista maksetaan EU:n pakolaisrahaston kautta Suomelle korvaus ("Hei me tienataan tällä, otetaan lisää!").

Järjestelmään liittyminen on vapaaehtoista, mutta Suomi on tukenut kaikkia yhteishankkeita. Oletan, että tämä merkitsisi Suomelle viimein ihan oikeaa sitoutumista tiettyyn kiintiöpakolaismäärään sellaisen kansainvälisen sopimuksen kautta, jollaista ei kaikista väitteistä huolimatta ole tähän asti ollut olemassa. EU tuntuu haluavan keskittyä kiintiöpakolaispolitiikassa Afrikan ja Lähi-idän pakolaisleirien tyhjentämiseen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.03.2012, 11:16:40
Yhdenmukaiset käytännöt parhaassa tapauksessa hyödyttävät kaikkia oikealla asialla olevia ja samalla vähentävät järjestelmällistä ihmiskauppaa, turvapaikkashoppailua ja niin edelleen. Nykyisistä konkreettisista epäkohdista hyötyvien mahdollisuudet rahastamiseen tullevat heikkenemään, positiivista tämäkin.

Vaikea sanoa, millainen sopimuskokonaisuus pullahtaa julki, mutta aivan varmasti tuloksena ei ole yhdenmukaiset käytännöt kaikkialla EU:ssa. Se on mahdotonta.

Minä en näe sopimuksessa voivan olla oikeastaan mitään positiivista. Parhaassakin tapauksessa voisimme vain palata parin vuoden takaiseen aikaan ennen Kreikan Dublin-palautusten kieltämistä.

Jos sopimus onnistuu nostamaan Etelä-Euroopan maiden suojelun tasoa, niin se tarkoittaa yhä enemmän liikennettä Eurooppaan ja lopulta myös Suomeen. Shoppailu ja ihmissalakuljetus ei suinkaan vähene, päinvastoin. Pohjoismaat pysyisivät anteliaan sosiaaliturvansa ansiosta edelleen houkuttelevina, mutta nyt myös eteläeurooppalaisella arvalla voisi voittaa. Eli tulijat saisivat entistäkin parempaa vastinetta ihmissalakuljettajille antamilleen rahoille.

Myöhemmin tulee "taakanjako ja solidaarisuus" eli tulijoiden jakaminen EU-maiden kesken, koska se on kuulunut alusta asti ideaan EU:n yhteisestä turvapaikkajärjestelmästä. Sitä ennen tapahtuu päätöksenteon keskittäminen ja pakolaiskorvauksia jakavan byrokratiamyllyn pystyttäminen. Ellei sitten koko hanketta peruta Euroopalle vahingollisena.

Pidän erittäin todennäköisenä mokuklusterin massiivista "itku ja parku ja maailmanloppu" -kampanjaa viimeistään siinä vaiheessa, kun CEAS alkaa olla allekirjoituksia vaille valmis.

Parkua on tullut jo nyt. Etenkin hiertää se, että Dublin-sopimusta ei lakkauteta, eikä Välimeren ja Kreikan rajavalvontaa heikennetä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.03.2012, 11:45:38
Parhaassa tapauksessa tulijoiden sosiaaliturva olisi pilkulleen sama kaikissa sopimuksen ratifioineissa maissa - ainakin paperilla.

Turvapaikanhakijoiden sosiaaliturvaan ei olla puuttumassa. Niiden erojen tasoittaminen olisi aivan liian iso urakka. Nyt määritellään mm. turvapaikan myöntämisen käytännön kriteerejä ja vastaanottojärjestelmän (minimi)vaatimuksia. En usko, että tällä saralla edetään vielä tässä ensimmäisessä vaiheessa juuri lainkaan, mutta ero entiseen on siinä, että nyt työtä tehdään nimenomaan CEASin puitteissa ja sen kehittämiseksi.

Missä byrokratiaa, siellä korruptiota - aina, iankaikkisesti, amen. Tämä on juuri se asia, jota eniten pelkään.

Samoin. Huonoa maahanmuuttopolitiikkaa ajavia poliitikkoja on vielä suhteellisen helppo vastustaa, mutta siinä vaiheessa kun sadat miljoonat EU-eurot löytävät oikeisiin taskuihin, syntyy pelottavan mahtava näkymätön voima.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vartiotorni - 05.03.2012, 14:10:31
Älkää pelätkö, sillä ilmoitan teille suuren ilon: EU tarvitsee vuoteen 2020 mennessä ainoastaan 120 miljoonaa muuttajaa -pakolaista tai muuta- "muilta mantereilta".
Tämä demografien mukaan Euroopan "yli-ikääntymisen" vuoksi, ts. väestöpyramidi on kippaamassa kärjelleen. Näiden tulokkaiden eläkkeistä ja vanhuuden päivistä huolehtimaan tarvitaan sitten 240 miljoona "muilta mantereilta", mutta se(kään) ei ole enää meidän murheemme. Me maksamme vain näiden ensimmäisten 120 miljoonan tulokkaan terveydenhoidon, lapsilisät ja varhaiseläkkeet eläkkeistämme ja sillä hyvä.
Unohdinpa, että lukuja täytyisi korjata vähän ylöspäin, sillä kun Afrikasta tulee yksi maahanmuuttaja -tietysti ahkera, kuten aina- muuttaa perheen yhteenliittämisen vuoksi perässä myös vaimo(t), lapset, vanhemmat, isovanhemmat, tädit, sedät, joista puolet on vanhuksia.... Sanokaamme siis lyhyesti: tulee koko kylä, jo valmiine vanhuksineen.
MIKÄLI tätä estäviä pykäliä on hiottu (esim. Suomessa), ne mitätöidään. Eihän hommasta tule muuten mitään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 07.03.2012, 07:37:47
Vaihteeksi jotain positiivista:
Lainaus
Viime perjantaina 2.3. suuressa valiokunnassa puutuin yhdessä muun PS-ryhmän kanssa EU:n yhteiseen turvapaikkapolitiikkaan siten, että esitimme jo tässä vaiheessa Suomen vastustavan taakanjakoa. Suomen kanta vaikuttaa valtioneuvoston ilmaisemana varsin epäselvältä tai ainakin tulkinnanvaraiselta, koska samalla valtioneuvosto ajaa maidenvälistä solidaarisuutta turvapaikkaongelmissa. Asiaan palataan vielä.
Vesa-Matti Saarakkalan blogi (http://www.saarakkala.fi/blogi/2012/03/06/234) 6.3.2012

Jos hallitus on toista mieltä, niin ei kun vääntämään asiasta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.03.2012, 00:27:06
Ystävällämme Cecilia Malmströmillä on asiaa.

Lainaus
Asylum: it's vital that Europe presents a united front

Our leaders must ensure populist rhetoric on asylum seekers – whose numbers are historically low – doesn't dictate the agenda

European promises to support people in need have been thoroughly tested in recent times and Europe collectively has failed in that test. We urgently need a common asylum system that rebalances the responsibility among EU member states.

In historical terms, the number of asylum seekers arriving in Europe is low but some points of entry are under enormous pressure and are not equipped to correctly process the claims of asylum seekers. This flawed system is not only unfair on those who seek refuge; it is also unfair on a public who need to know that the system is helping those most in need.

I will be discussing the common European asylum system with home affairs ministers from all EU countries on 8 March, and I'll be looking to participants to step up their efforts, as negotiations have so far been too slow.

Part of the reason can be seen in our economic climate. But as the crisis has kept the European Union looking inward for many months now, unrest in northern Africa and elsewhere has forced many to leave their homes. So, can Europe stay committed to helping those in need of shelter, while handling our own economic difficulties?

[...]

However, the political mood in many EU member states is sour. We have not seen as many populist and xenophobic parties in European national parliaments since before the second world war. True to form, they exploit the current crisis, trying to shift the blame on to immigrant populations. Here, we need European and national leadership to make sure that populist rhetoric does not dictate the agenda.

Because, contrary to what the xenophobes would have us believe, the number of asylum seekers in Europe is far lower today than 10 years ago. And Europe is by no means exceptionally open in its asylum policies. There are far more refugees in Kenya alone than in the 27 EU countries.

However, unforeseen events like the Arab spring can overstretch the asylum capacity of any country, and Europe has to be prepared to support member states so that people are received in dignity.

Despite common minimum rules, several countries' asylum systems provide unacceptable reception conditions for migrants. And standards in granting refugee status differ greatly between countries. Such disparities are not acceptable in an EU where we have signed the same international conventions and unite around the same values. The EU needs common high standards and stronger co-operation to ensure that asylum seekers are treated equally in an open and fair system – wherever they apply.

That is why the EU has been inching towards a common asylum policy for over a decade, and has set a deadline of 2012 for putting the common system into place. But, again, negotiations are too slow-moving and talks need to be intensified.

I am convinced that we are perfectly capable of dealing with our economic difficulties while staying true to our ideals of openness, tolerance and solidarity. Our commitment cannot be a zero-sum game. This year, I expect all the ministers in the council to make good on their promises, commit to mutual assistance and finally put the common asylum system into place.
The Guardian (http://www.guardian.co.uk/commentisfree/2012/mar/07/asylum-europe-present-united-front) 7.3.2012

Näin siis komissaari Malmström, jonka mielestä EU:n olisi pitänyt arabikevään aikana ottaa käyttöön erityisdirektiivi ja myöntää oleskeluluvat kaikille tulijoille.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.03.2012, 00:45:50
Malmströmin mainitsemasta kokouksesta:

Lainaus
Oikeus- ja sisäasiainneuvosto keskittyy maahanmuuttoasioihin

EU:n oikeus- ja sisäasiainneuvosto kokoontuu yksipäiväiseen kokoukseen 8. maaliskuuta Brysseliin. Suomea kokouksessa edustaa sisäministeri Päivi Räsänen. Kokous keskittyy maahanmuuttoasioihin ja Schengen-alueen hallinnoinnin kehittämiseen.

Kokouksessa ministerit saavat tilannekatsaukset

 -   yhteisen eurooppalaisen turvapaikkajärjestelmän lainsäädäntöpaketista
 -   Kreikan ohjelmasta turvapaikka- ja maahanmuuttohallintonsa uudistamiseksi
 -   suunnitelmasta laittoman maahanmuuton vastaisen työn tehostamiseksi

Lisäksi ministerit hyväksynevät neuvoston päätelmät solidaarisuudesta erityisten maahanmuuttopaineiden alaiseksi joutuvien maiden auttamiseksi. Suomi pitää tärkeänä lähtökohtaa, jonka mukaan kaikilta toimijoilta, niin jäsenvaltioilta kuin EU-toimielimiltäkin, odotetaan nyt yhteistä sitoutumista ja käytännön aktiivisuutta. Samalla korostetaan sitä, että perimmäinen vastuu turvapaikkajärjestelmien toimivuudesta on jäsenvaltioilla itsellään.
Sisäasiainministeriön tiedote (http://www.intermin.fi/intermin/home.nsf/pages/BF70E8588025EB2CC22579BA002515F7?OpenDocument) 7.3.2012

Solidaarisuutta, yhteistä sitoutumista ja käytännön aktiivisuutta. Selvä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.03.2012, 18:05:59
Council conclusions on a Common Framework for genuine
and practical solidarity towards Member States facing
particular pressures on their asylum systems, including
through mixed migration flows

3151st JUSTICE and HOME AFFAIRS Council meeting
Brussels, 8 March 2012 (http://www.consilium.europa.eu/uedocs/cms_data/docs/pressdata/en/jha/128820.pdf)

Avainsana on solidaarisuus, joka mainitaan kahdeksansivuisessa dokkarissa 28 kertaa.

Financial Solidarity
Resursseja.

Solidarity through Relocation
Turvapaikanhakijoiden vastaanotto toisilta jäsenmailta.

Solidarity through the Temporary Protection Directive
Oleskelulupien myöntäminen EU-alueelle ilman tutkintaa poikkeuksellisen massamaahanmuuton sattuessa (vrt. arabikevät).

Joint EU Processing of Asylum Claims as a possible tool of Solidarity
Vuoden 2012 loppuun mennessä valmistuu selvitys jäsenmaiden yhteisestä turvapaikkahakemusten käsittelystä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ruckafella - 08.03.2012, 18:25:21

Financial Solidarity
Resursseja.

Solidarity through Relocation
Turvapaikanhakijoiden vastaanotto toisilta jäsenmailta.

Solidarity through the Temporary Protection Directive
Oleskelulupien myöntäminen EU-alueelle ilman tutkintaa poikkeuksellisen massamaahanmuuton sattuessa (vrt. arabikevät).

Joint EU Processing of Asylum Claims as a possible tool of Solidarity
Vuoden 2012 loppuun mennessä valmistuu selvitys jäsenmaiden yhteisestä turvapaikkahakemusten käsittelystä.

Puola, Tsekki, Unkari, Slovakia ja Baltian maat eivät tule ottamaan ainakaan Afrikasta yhtäkään pakolaista lisää tämänkään pelleilyn jälkeen. Puola pelaa itselleen vapautuksen estämällä koko EU:n toiminnan ja vedoten teknisesti johonkin köyhyyteen tms ja muut peesaavat. Suomi kuittaa ja korottaa quotaansa  >:(

Poikkeuksellisen massamuuton sattuessa?? Sanoisin, että poikkeuksellinen massamuutto on ollut käynnissä Suomessa jo pari vuosikymmentä, mutta siis yleisemmin tuo tarkoittaa, että jos tulijoita on tarpeeksi, kaikki halukkaat pääsevät sisään. Mitä järkeä??
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.03.2012, 18:43:27
Poikkeuksellisen massamuuton sattuessa?? Sanoisin, että poikkeuksellinen massamuutto on ollut käynnissä Suomessa jo pari vuosikymmentä, mutta siis yleisemmin tuo tarkoittaa, että jos tulijoita on tarpeeksi, kaikki halukkaat pääsevät sisään. Mitä järkeä??

Juuri sitä se tarkoittaa. Komissaari Cecilia Malmström, maahanmuuttoministeri Astrid Thors sekä pakolais- ja ihmisoikeusjärjestöt olivat vuosi sitten sitä mieltä, että tämä tilapäisen suojelun direktiivi (http://hommaforum.org/index.php/topic,42994.msg586949.html#msg586949) olisi pitänyt aktivoida jäsenmaiden päätöksellä. Näin ei kuitenkaan tehty.

Ai mitä järkeä. Että elämä olisi mielenkiintoisempaa. Olisi meinaan nyt koko Eurooppa ihan eri asennossa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: akez - 08.03.2012, 19:02:17
Henkilö (Cecilia Malmström), joka argumentoi käyttäen solvauksia - ksenofobi, populisti - ei ole vakavasti otettava taho. Ei edes vaikka olisi päässyt Ruotsista kiintiökomissaariksi. Komissaarin vihapuheille on asetettava nollatoleranssi. Tsaarien aika meni jo ja samoin politrukkien.

Karmea visio syntyy siitä, että mm. Merkel on kaavaillut EU:n ylimmän vallan siirtämistä epädemokraattisesti valitulle Komissiolle, jonka jäsenenä voi sitten olla Malmströmin kaltaisia henkilöitä. Itänaapurin romahduksesta 20 vuoden takaa ei ole ilmeisesti vieläkään opittu mitään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vartiotorni - 09.03.2012, 01:35:46
Kreikan rajoilla silmukkakoko 5 x 5 metriä. Ukkoa lappaa EU-alueelle KOLMINUMEROISESTI PÄIVÄSSÄ. Viimeistään Unkarista alkaen täysin vapaa reitti. Ensimmäisenä pohjoisessa on kovilla Itävalta, jossa joutuu kiinni vuosittain 21.000 luvatonta rajanylittäjää, joista suurin osa palautetaan tulomaihin -yrittämään uudestaan. YKSIKÄÄN ei halua itäblokin maihin -NIIN suurta hengenhätää ei ole kenelläkään.
Pakolaisten salakuljetus on kuulemma jo kannattavampaa kuin huumausaineen.
3000 euroa per nuppi on keskihinta ja usein ahdetaan 20-30:kin johonkin rekkaan, tavallisemmin kuitenkin ylitetään vihreä raja jalkaisin. Kiinni joudutaan, mikäli ei murtautumisyrityksestä, niin sitten kun hortoillaan kylällä ja kysellään tietä Wieniin, Müncheniin tai Berliiniin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 09.03.2012, 01:51:50
Kreikan rajoilla silmukkakoko 5 x 5 metriä. Ukkoa lappaa EU-alueelle KOLMINUMEROISESTI PÄIVÄSSÄ.

Itävalta ja Saksa ovat uhanneet ottaa käyttöön rajatarkastukset, jos Kreikan EU-ulkorajojen valvontaa ei saada kuntoon. Komissaari Malmströmin edustaja torjui tällaisen heti Schengenin vastaisena. Myös Ranska, Belgia, Hollanti, Ruotsi ja Iso-Britannia vaativat Kreikalta ja Turkilta tehostettua toimintaa laittoman maahantulon suitsimiseksi.

Lainaus
Germany and Austria on Thursday raised the stakes for cash-strapped Greece to implement proper migration controls, saying that other European countries could consider reinstituting border controls if it does not stem the flow of illegal immigrants.

"The (Greek) border is open like a barn door," Austrian Interior Minister Johanna Mikl-Leitner told reporters in Brussels. "The pressure on Greece must be increased ... It cannot be that a member state which does not do its homework gets away with it scot-free."

"The question is still open on what happens when a country is not in a position to sufficiently safeguard its borders - as we are currently experiencing in Greece," German Interior Minister Hans-Peter Friedrich added.

He said discussions are being held over "it being possible" to reintroduce border controls.
EuropeOnline: Germany, Austria raise border-check spectre amid Greek migrant woes (http://en.europeonline-magazine.eu/germany-austria-raise-border-check-spectre-amid-greek-migrant-woes_195711.html) 8.3.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vartiotorni - 13.03.2012, 02:21:08

Financial Solidarity
Resursseja.

Solidarity through Relocation
Turvapaikanhakijoiden vastaanotto toisilta jäsenmailta.

Solidarity through the Temporary Protection Directive
Oleskelulupien myöntäminen EU-alueelle ilman tutkintaa poikkeuksellisen massamaahanmuuton sattuessa (vrt. arabikevät).

Joint EU Processing of Asylum Claims as a possible tool of Solidarity
Vuoden 2012 loppuun mennessä valmistuu selvitys jäsenmaiden yhteisestä turvapaikkahakemusten käsittelystä.

Puola, Tsekki, Unkari, Slovakia ja Baltian maat eivät tule ottamaan ainakaan Afrikasta yhtäkään pakolaista lisää tämänkään pelleilyn jälkeen. Puola pelaa itselleen vapautuksen estämällä koko EU:n toiminnan ja vedoten teknisesti johonkin köyhyyteen tms ja muut peesaavat. Suomi kuittaa ja korottaa quotaansa  >:(

Poikkeuksellisen massamuuton sattuessa?? Sanoisin, että poikkeuksellinen massamuutto on ollut käynnissä Suomessa jo pari vuosikymmentä, mutta siis yleisemmin tuo tarkoittaa, että jos tulijoita on tarpeeksi, kaikki halukkaat pääsevät sisään. Mitä järkeä??
Puolan, Tsekkien ym. entisen itäblokin maiden ei edes tarvitse pelätä, että sinne tulisi pakolaisia. NIIN suurta hätää ei sentään ole kenelläkään jos naapurimaissa (Italiassa, Itävallassa, Saksassa jne.) saa majatalomajoituksen, ruuan, vuosilipun julkisiin liikennevälineisiin, TV:n, vapautuksen puhelinmaksuista, avustusjärjestöt vaatettaa merkkiliikkeistä ja käteen annetaan vielä taskurahaakin.
Tuollainen pakolainen maksaa veronmaksajille länsimaissa 12-15.000 e vuodessa  -Itä-Euroopassa ei moiseen uhrattaisi siitä kolmasosaakaan. Parakkiin pihalle ja soppakanuuna. Ei sodan jälkeen ollut miljoonilla Euroopassa sitäkään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 13.03.2012, 02:36:53
Mikä ihmeen vimma on tuhota eruooppaa ja mahdollisimman nopeasti?

Päättäjät vissiin pitävät Raamatun ilmestyskirjaa käsikirjoituksena mitä pitää noudattaa kirjaimellisesti...

Muuten, olen sitä mieltä että nyt kun useimmat Euroopan führereistä ovat jo tunnustaneet massamaahanmuuton ongelmat välimeren maissa, ja osittain keskelläkin Eurooppaa, niin uskoisin heidän pikkuhiljaa rajoittavan liikkumista EU:n sisällä. En siis usko että tuo heidän "vastuunkanto" olisi sitä mamujen jakamista. Sarkozyn vaalivaatimus antaa osviittaa.

Vielä pitää eu-führereiden nuivistua melko paljon ennenkuin alkaa mennä paremmin. Jos siis uusi nousukausi on edes teoriassa mahdollista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 13.03.2012, 02:37:00
Puolan, Tsekkien ym. entisen itäblokin maiden ei edes tarvitse pelätä, että sinne tulisi pakolaisia.

Kyllä niitä vaan tulee. Puolassakin enemmän turvapaikanhakijoita kuin Suomessa ja laittomasti maassa oleskelevat siihen päälle.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: AIP - 13.03.2012, 05:29:33
Taakanjaossa olisi etäisesti jotain järkeä, mikäli siinä huomioitaisiin vastaanotettavan henkilön todennäköisesti aiheuttamat kustannukset vastaanottavalle valtiolle käyttäen joitakin tunnettuja muuttujia, kuten keskimääräinen työmarkkinoiden ulkopuolelle jäänti tai sosiaaliturvakustannukset. Heittäydytään saman tien rassisteiksi ja tunnustetaan esimerkiksi kuormitus vankeinhoitojärjestelmälle. Tämä tasaisi kuormaa ottaen huomioon EU-maiden erot surkean ja vahvan sosiaaliturvan välillä. No, turhassa toivossa huono elää.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 13.03.2012, 06:44:47
Taakanjaosta ei voi puhua niin kauan kun tiedossa ei ole, miten monta tulijaa maan X tulisi kaikkiaan ottaa: tulijoiden virtahan on käytännössä loputon. Taakanjakosuunnitelmassa pitäisi kertoa se maksimimäärä, mikä voidaan ottaa maan kantokyky, talous, populaatio ja sosiaaliset näkökohdat huomioiden. Tässä pitää ottaa huomioon myös demografiset seikat ja tunnustaa niinikään maahanmuuttajien syntyvyyden vaikutus pitkällä tähtäimellä. Lisäksi taakanjakoon tulee luonnollisesti sisällyttää mahdollisuus ryhtyä palautuksiin, mikäli maahanmuuttajien määrä jollakin mittarilla alkaa kohtuuttomasti haitata isäntämaata. Esimerkiksi tavaton huoltosuhteen heikennys tai maan katastrofaalisen huono työllisyystilanne - esim. yli 10% - antaisi oikeuden ryhtyä palautuksiin.

Edellinen huomioonottaen on selvää, että esimerkiksi Suomi on jo nyt ottanut tätä taakkaa kestokykyään enemmän ja palautuksiin olisi Suomenkin osalta ryhdyttävä heti ensimmäisenä arkipäivänä: muistakaamme esimerkiksi, että vaikkei maahamme tulisi enää ainuttakaan somalia, silti heidän määränsä nykyisellä syntyvyydellä johtaa siihen, että joskus ensivuosisadalla somaleiden määrä Suomessa lasketaan miljoonissa.

Näin ollen taakat on jo jaettu. Liiankin kanssa. On aika palautusten alkaa kautta koko Euroopan. Sillä taakanjaon tarkoituksena ei voi olla isäntämaan taloudellinen, sosiaalinen ja kulttuurillinen tuhoaminen. Ellei sitten ole.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 13.03.2012, 11:30:57
Tehtävä on mahdoton koska Afrikasta vuotaa vaikkapa satoja miljoonia ihmisiä sisään etelän maihin tarpeen vaatiessa. Vaellus pohjoiseen ei siis tule helpottamaan etelän maahanmuuttokriisiä. Siihen löytyy vain yksi keino - rajat kiinni.

Rajojen vedenpitävä valvonta on melko mahdotonta, vaikka sellaiseen viimein löytyisi tahtoakin. Mielestäni alueelle pääsemisen estämiseen keskittyminen on strategiana tuomittu epäonnistumaan (vrt. turvallisuusfilosofisesti keskittyminen ydinvoimalaonnettomuuden estämiseen). Kannattaisi painottaa enemmän sitä, mitä tehdään siinä tilanteessa, kun väistämätön vahinko tapahtuu. Päällimmäisin ongelmahan on tällä hetkellä se, että sisään päässeitä on vaikea poistaa pakkokeinoin EU:n alueelta. Tähän on keksittävä keinot esimerkiksi palautussopimuksin.

YK:n pakolaissopimuksen velvoitteet voisi täyttää täysin toisella tavalla järjestämällä ihmisille turvaa EU:n ulkopuolelta, esimerkiksi Afrikasta. Jos ihmissalakuljettajille EU-alueelle pääsystä maksettu kymppitonni on yhä useammalle tyhjä arpa (tai menolippu Tansaniaan), niin Eurooppaan suuntautuva laiton siirtolaisuus ja sen mukana turvapaikanhakijaliikenne vähenee nopeasti murto-osaan nykyisestä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vartiotorni - 13.03.2012, 17:31:13
Puolan, Tsekkien ym. entisen itäblokin maiden ei edes tarvitse pelätä, että sinne tulisi pakolaisia.

Kyllä niitä vaan tulee. Puolassakin enemmän turvapaikanhakijoita kuin Suomessa ja laittomasti maassa oleskelevat siihen päälle.
Tarkasti ottaen olet oikeassa. Mutta näiden LOPULLINEN tavoite on päästä Länsi-Eurooppaan. Puolan suhteen on vielä lisäksi mainittava, että siellä on tällä hetkellä koko EU-alueen suurin taloudellinen kasvu. Rotatkin huomaavat heti, että uusi kaatopaikka saattaa tarjota enemmän kuin vanha ja lähiaikoina loppuunkaluttu tai hermeettisesti suljettu (rotanreijät tukittu).
Puola on sisääntuloväylä nr. 1 idästä (Valko-Venäjä, Venäjä, Ukraina jne.) tuleville, joka selittää laittomasti maahan tulevat. Mutta useimmiten ei sinne jäävät. Jo ennen Schengen-sopimuksen voimaantuloa sanottiin Puolassa odottavan 200.000 "vaeltavan etnisen vähemmistön edustajaa" pääsyä (tai salakuljetusta) Saksaan ja länteen. Nythän nämä saavat tulla vapaasti niin Romaniasta, Slovakiasta kuin Unkaristakin, joissa näitä on yli 2 miljoonan reservit.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 19.03.2012, 19:02:39
COMMUNICATION FROM THE COMMISSION TO THE EUROPEAN PARLIAMENT, THE COUNCIL, THE EUROPEAN ECONOMIC AND SOCIAL COMMITTEE AND THE COMMITTEE OF THE REGIONS
on enhanced intra-EU solidarity in the field of asylum
An EU agenda for better responsibility-sharing and more mutual trust (http://eur-lex.europa.eu/smartapi/cgi/sga_doc?smartapi!celexplus!prod!DocNumber&lg=EN&type_doc=COMfinal&an_doc=2011&nu_doc=835) 2.12.2011

Lainaus
Johdanto

Solidaarisuus on yksi Euroopan unionin perusarvoista, ja se on ollut Euroopan yhteisen turvapaikkapolitiikan johtava periaate siitä saakka, kun politiikkaa vuonna 1999 ryhdyttiin kehittämään. Solidaarisuuden periaate on nyt kirjattu myös Euroopan unionin toiminnasta tehdyn sopimuksen 80 artiklaan.

Solidaarisuus on tunnustettu alusta saakka yhteisen eurooppalaisen turvapaikkajärjestelmän olennaiseksi elementiksi. Tarve muuttaa solidaarisuuden idea konkreettisiksi toimiksi lähtee käytännön tosiasioista, sillä kaikkien jäsenvaltioiden turvapaikkajärjestelmät ovat riippuvaisia toisistaan. Jos yhden jäsenvaltion järjestelmä ylikuormittuu tai toimii huonosti, tämä vaikuttaa selvästi kaikkiin muihin mutta myös turvapaikanhakijoiden liikkumiseen jäsenvaltiosta toiseen. Turvapaikanhakijavirrat eivät pysy jatkuvasti samanlaisina, eivätkä ne ole yhtä suuria joka puolella EU:ta. Turvapaikanhakijoiden määrä on vaihdellut 425 000 hakemuksesta (EU-27:n huippulukema vuonna 2001) alle 200 000 hakemukseen vuonna 2006, ja tälle vuodelle odotetaan merkittävää kasvua. Kasvaneet turvapaikanhakijoiden määrät saattavat asettaa koetukselle eräiden jäsenvaltioiden selviytymisvalmiudet. Näiden jäsenvaltioiden auttaminen on Euroopan unionin tehtävä myös siksi, että unionin yhteisistä arvoista ja perusoikeuksista on voitava pitää kiinni varmistamalla turvapaikanhakijoiden ja pakolaisten asianmukainen vastaanotto ja suojelu.

[...]

Lainaus
VASTUUNJAKOKYSYMYKSET

Dublin-asetus kaipaa uudistamista

Dublin-asetuksen tavoite eli se, että jokaisesta turvapaikanhakijasta vastaa jokin jäsenvaltio, on edelleen yhteisen eurooppalaisen turvapaikkajärjestelmän keskiössä. Turvapaikkahakemuksista otettavan vastuun määrittelyyn tähtäävä mekanismi on edelleen tarpeen, jotta oikeus päästä tehokkaasti pakolaisaseman määrittelyprosessiin voidaan taata tinkimättä turvapaikkahakemusten käsittelyn nopeuttamistavoitteesta. Samassa yhteydessä on syytä estää järjestelmän väärinkäyttö siten, että sama henkilö hakee turvapaikkaa useita kertoja eri jäsenvaltioista.

Dublin-asetuksen periaatteena, josta komissio halusi pitää kiinni vuonna 2008 antamassaan asetuksen uudistamista koskevassa ehdotuksessa, ei ole pelkästään se, että turvapaikanhakijat palautetaan siihen maahan, jonka alueelle he ovat ensimmäisenä saapuneet. Tätä ehtoa lievennetään useilla säännöksillä. Tietyissä tilanteissa Dublin-asetuksen nojalla siirrettävien henkilöiden määrä saattaisi osaltaan ylikuormittaa jo ennestään voimakkaan paineen kohteena olevan jäsenvaltion kapasiteettia, mistä olisi haittaa kyseisen jäsenvaltion lisäksi myös hakijoiden oikeuksille.

[...]

Lainaus
Kansainvälistä suojelua saavien henkilöiden uudelleensijoittamisen kehittäminen

Uudelleensijoittaminen tarkoittaa, että henkilöt, jotka saavat kansainvälistä suojelua tai ovat sitä hakeneet, siirretään yhdestä jäsenvaltiosta toiseen, ja samalla vastaanottava jäsenvaltio ottaa vastuun hakemuksen käsittelystä tai kotouttamistoimenpiteistä.

Kansainvälistä suojelua hakeneiden henkilöiden uudelleensijoittaminen ennen heidän suojelutarpeensa arviointia on kiistanalaista. Jotkut sidosryhmät pitävät toimenpidettä hyödyllisenä tai jopa välttämättömänä ja muutamat jäsenvaltiot jopa kannattavat myös laittomien maahantulijoiden uudelleensijoittamista. Toiset taas vastustavat koko ajatusta. On monessa suhteessa kyseenalaista, miten tällainen toiminta sopii yhteen Dublin-järjestelmän kanssa, onko toiminta muihin solidaarisuustoimiin verrattuna käytännössä hyödyllistä ja kustannustehokasta tai millaisia vaikutuksia sillä on hakijoihin itseensä. Komissio ei pidä tällä hetkellä tarpeellisena esittää EU:n tason mekanismia kansainvälistä suojelua hakeneiden henkilöiden uudelleensijoittamista varten. Tästä huolimatta komissio on kuitenkin sisällyttänyt turvapaikka- ja maahanmuuttorahastoa koskevaan esitykseen mahdollisuuden myös sille, että tällaiselle toiminnalle myönnettäisiin unionin osarahoitusta. Näin lujitetaan ja kehitetään edelleen toimia, jotka ovat jo mahdollisia Euroopan pakolaisrahaston puitteissa. Vapaaehtoishankkeisiin mielellään osallistuvat jäsenvaltiot voivat toimia edelläkävijöinä, ja EASO omaksuu koordinoivan roolin. Osarahoituksesta voisi olla hyötyä myös hätätilanteissa.

Sen sijaan kansainvälistä suojelua jo saavien henkilöiden uudelleensijoittamisen hyödyllisyydestä ja tarpeellisuudesta vallitsee yksimielisyys. Komissio esitti kesäkuussa 2009 koko EU:n laajuista, Euroopan pakolaisrahastosta osittain rahoitettua EUREMA-pilottihanketta (uudelleensijoittamista koskeva Maltan EU-pilottihanke). Hanke päättyi kesällä 2011, jolloin 227 kansainvälistä suojelua saavaa henkilöä oli uudelleensijoitettu Maltalta kuuteen muuhun jäsenvaltioon.

[...]

Toinen uusi asia on pitkäaikaisia oleskeluoikeuksia koskevan muutetun direktiivin hyväksyminen. Direktiivillä annetaan kansainvälistä suojelua saaville henkilöille tiettyjä oikeuksia ja myönnetään heille yhdenvertainen kohtelu sekä oikeus muuttaa viiden vuoden oleskelun jälkeen toiseen jäsenvaltioon. Kyseessä ei sinänsä ole solidaarisuustoimenpide, mutta siitä voi olla apua tiettyihin jäsenvaltioihin kohdistuvan paineen lieventämisessä, jos merkittävä määrä kansainvälistä suojelua saavia henkilöitä päättää tiettyjen ehtojen vallitessa muuttaa toiseen jäsenvaltioon.

Lainaus
Mahdollisuudet hakemusten yhteiskäsittelyyn unionin alueella

Unionin alueen turvapaikkahakemusten yhteisestä käsittelystä puhuttiin ensimmäisen kerran Haagin ohjelmassa. Tukholman ohjelmassa kehotettiin komissiota saattamaan loppuun turvapaikkahakemusten mahdollisen yhteiskäsittelyn toteuttamiskelpoisuutta sekä oikeudellisia ja käytännöllisiä vaikutuksia koskeva tutkimuksensa.

Yhteiskäsittelyyn liittyy monia vielä epäselviä kysymyksiä. Perustavanlaatuisista kysymyksistä yksi koskee sellaisten tilanteiden määrittelyä, joissa yhteiskäsittelystä olisi mahdollisesti hyötyä. Harkintaa vaativia oikeudellisia ja hallinnollisia kysymyksiä ovat muun muassa yhteensopivuus EU:n lainsäädännön kanssa, oikeusperusta perussopimuksissa, tehokkaat oikeussuojakeinot, hakijoiden asema yhteiskäsittelyssä, kenelle päätöksentekovalta kuuluu, yhteys suojelun siirtämiseen ja/tai turvapaikkapäätösten vastavuoroiseen tunnustamiseen sekä yhteensovittaminen Dublin-järjestelmän kanssa. Taloudelliset kysymykset koskevat muun muassa kustannusten suuruutta kokonaan kansalliseen menettelyyn verrattuna sekä rahoitusmekanismeja. Tarkasteltavia käytännöllisiä kysymyksiä ovat esimerkiksi se, missä yhteiskäsittely tapahtuu, sekä mahdollinen etätyön hyödyntäminen. Yhteiskäsittelyssä olisi luonnollisesti kunnioitettava hakijoiden kaikkia oikeuksia.

Unionin alueen yhteiskäsittelystä voisi muodostua hyödyllinen solidaarisuuden työkalu. Sillä voitaisiin auttaa paineen alaisena olevia jäsenvaltioita vähentämään tapausten ruuhkautumista, jolloin sillä tuettaisiin Dublin-järjestelmää. Sen avulla voitaisiin levittää parhaita toimintatapoja ja jakaa teknistä asiantuntemusta, mikä lisäisi myös turvapaikkajärjestelmien yhdenmukaisuutta, kun keskinäinen luottamus niitä kohtaan lisääntyisi. Koska turvapaikanhakijoiden määrät vaihtelevat suuresti, joissakin jäsenvaltioissa työmäärä on aika ajoin suhteellisen vähäinen. Tällöin niillä saattaa olla ylimääräistä henkilöstökapasiteettia, jota voidaan hyödyntää muiden jäsenvaltioiden avustamisessa. On syytä tutkia, voitaisiinko resursseja lainata tai jakaa jäsenvaltioiden kesken kapasiteetin mukaan, mahdollisesti EASOssa kehitettävinä oleviin, virkamiesten lähettämistä koskeviin menettelyihin liittyen.

Komissio aikoo käynnistää selvityksen, jossa näitä kysymyksiä tarkastellaan tarkemmin. Tuloksia on mahdollisesti odotettavissa vuoden 2012 lopulla.

Lainaus
Kohtuullinen vastuunjako poikkeuksellisissa olosuhteissa

Sen lisäksi, että tulevassa uudelleensijoittamista koskevassa pysyvässä ohjelmassa on hätätilanteita koskeva osa, siirtymään joutuneiden henkilöiden joukoittaisen maahantulon tilanteissa komissio harkitsee aina tilapäistä suojelua koskevan direktiivin mekanismin käyttöönottoa, jos sitä koskevat ehdot täyttyvät. Direktiivi on poikkeustilanteissa hyödyllinen väline. Siinä säädetään tilapäistä suojelua saavien henkilöiden asemasta, mutta samalla kevennetään turvapaikkajärjestelmään kohdistuvaa painetta ja luodaan jäsennelty mutta vapaaehtoinen mekanismi, jolla tilapäistä suojelua saavia henkilöitä voidaan siirtää jäsenvaltioiden välillä. Mekanismin käyttöönotolle on kuitenkin määritelty tiukat ehdot: se voidaan ottaa käyttöön vain silloin, kun kyseessä on jo alkanut tai välittömästi uhkaava joukoittainen maahantulo, jossa siirtymään joutuneet henkilöt eivät voi palata lähtömaahansa turvallisesti ja pysyvästi, erityisesti jos on myös vaara, että turvapaikkajärjestelmä ei kykene käsittelemään tätä maahantuloa sen toimivuuden heikentymättä. Joukoittainen maahantulo tarkoittaa, että yhteisön alueelle tulee suuri määrä siirtymään joutuneita henkilöitä, jotka ovat lähtöisin tietystä maasta tai tietyltä maantieteelliseltä alueelta, riippumatta siitä, tulevatko he unionin alueelle omasta aloitteestaan tai avustettuna, esimerkiksi evakuointiohjelman kautta. Siirtymään joutuneiden henkilöiden joukoittaista maahantuloa ei ole koettu unionissa vuonna 1999 tapahtuneen Kosovon pakolaiskriisin jälkeen. Tapahtumat Välimeren eteläpuolella vuonna 2011 eivät ole aiheuttaneet vastaavanlaista maahantuloa EU:n alueelle.

[...]
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: akez - 19.03.2012, 19:42:58
Unionin alueen yhteiskäsittelystä voisi muodostua hyödyllinen solidaarisuuden työkalu. Sillä voitaisiin auttaa paineen alaisena olevia jäsenvaltioita vähentämään tapausten ruuhkautumista, jolloin sillä tuettaisiin Dublin-järjestelmää.

Tässä olisi parempi ja hyödyllisempi solidaarisuuden kohde ruuhkautumisen estämiseksi. Näin aluksi.

"Kreikka pystyttää 10 kilometriä pitkän muurin estääkseen laitonta maahantuloa Turkista. EU kieltäytyy antamasta Ateenalle varoja sen rakentamiseksi." Linkki juttuun. (http://hommaforum.org/index.php/topic,68946.msg962278.html#msg962278)

Kehitysavustamme voisimme lohkaista osan Kreikan hankkeeseen (vaikka huussiseuralta). Lisäksi meillä on hyödyllistä asiantuntemusta myös näistä pakolaisten palautuskysymyksistä Neuvostoliiton ajoilta. Ei mennyt meiltä maine, eikä kukaan perään huudellut, vaikka bumerangina tuolloin kaikki takaisin meni. Edes vasemmisto ei inahtanut asiasta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 20.03.2012, 12:26:32
Lainaus
Asylum Policy in the EU: The Case for Deeper Integration

By
Timothy J Hatton
(University of Essex and Australian National University)

February 2012

Abstract: Over the last decade the locus of policy-making towards asylum seekers and refugees has shifted away from national governments and towards the EU as the Common European Asylum Policy has developed. Most of the focus has been on the harmonisation of policies relating to border control, the processing of asylum claims and reception standards for asylum seekers. But this still falls far short of a fully integrated EU-wide policy. This paper examines the basis upon which a joint EU policy can be justified. I then ask whether superior outcomes can be achieved by harmonisation alone or if more centralised policy-making is necessary. I chart the progress of harmonisation and burden-sharing in the development of the Common European Asylum System and explore its effects. I also study the political feasibility of deeper policy integration by analysing public attitudes in the European Social Survey. I conclude that deeper integration is both desirable and politically possible.

Keywords: Refugees, Asylum seekers, Asylum policy, Harmonisation, Burden-sharing
Asylum Policy in the EU: The Case for Deeper Integration (http://econpapers.repec.org/paper/norwpaper/2012016.htm)

Lainaus
1. Introduction
2. The case for cooperation
3. The evolution of policy
4. The distribution of asylum applications and burden-sharing
5. Who is against asylum seekers and refugees?
6. Who is in favour of international policy-making?

7. Could the EU do better?
Conclusion

Lainaus käyttäjältä: Asylum Policy in the EU: The Case for Deeper Integration
Thus in the recent past changes in asylum policies have done little to promote burden-
sharing; if anything they seem to have done the opposite. This is consistent with the
theoretical framework presented above, which suggests that policy harmonisation could
lead to divergence in refugee burdens. It has led to further consideration of the possibility
of redirecting asylum applications in order to even out the numbers, relative to some
measure of capacity. One study for the EU Commission applied several different burden-
sharing formulas to the data on asylum applications for 2008. The capacity measures include
total population, GDP per capita and population density, which are combined with different
sets of weights. These calculations imply that out of 242,000 asylum applications, between
one third and 40 percent would be transferred from the country of original application

(European Commission 2010, p. 30). A large share of the relocation would be from the EU-
15 to the newer member states
—a transfer that would amount to between 15 and 18
percent of the overall total.

Another report, this time for the European Parliament, uses a similar range of capacity
measures to investigate the scale of potential transfers in 2007 (Thielemann et al., 2010, p.
127). In this case transfers of between 11 and 16 percent of the total inflow would be
envisaged. They also examine scenarios where there is a financial transfer rather than
physical relocation of refugees. As the model above illustrates, countries could be
compensated to different degrees for excess burdens through a financial burden-sharing
scheme
. However as Thielemann et al. (2010, p. 47) point out this would involve vastly
larger sums than are currently available through the ERF
. According to their estimates the
total amount to be distributed by the ERF to member states over the years 2008-13 is just
14 percent of asylum costs for the EU-27 for the single year 2007. They conclude that a
policy of redistribution “is the only mechanism that is likely to have a real impact on the
distribution of asylum costs and responsibilities across member states”
(Thielemann et al.,
2010, p. 143).

These comparisons raise several other issues. One is whether relocation should apply to
asylum applicants or only to those recognised as refugees. Most governments evidently
prefer the latter (European Commission, 2010, pp. 39-43). Although relocating asylum
seekers would be more costly, it has the virtue of being a one-step procedure. Transferring
applicants prior to determining their refugee status would also attenuate the incentive for
an individual country to be ‘too’ generous in granting refugee status—in the knowledge that
excess refugees would be transferred elsewhere. This also points to the importance of more
complete harmonisation of asylum procedures, so that relocation would not imply radical
differences in the probability of rejection. More complete harmonisation would be a
necessary condition for gaining the consent of the asylum applicant to be transferred from
one country to another, if consent was to be required.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 22.03.2012, 12:50:30
Lainaus
Refugee resettlement priorities for 2013

On 8 March 2012 the Justice and Home Affairs Council adopted a decision which introduces EU refugee resettlement priorities for 2013, as well as new rules on the financial support that the member states receive from EU funds to accommodate refugees from outside the EU in their territories (resettlement).

Under the new decision, member states will be entitled to receive from the European Refugee Fund a fixed amount of:

- EUR 6 000 per resettled refugee, if they are applying for such compensation for the first time;
- EUR 5 000 per refugee, if the state had already applied for such compensation once before;
- EUR 4 000 for all other states.

These new co-financing rules are an addition to the existing legal framework that regulates the European Refugee Fund (EUR 630 million) over the period 2008-2013. The Fund was established to co-finance national efforts in receiving refugees and displaced persons and guaranteeing them access to consistent, fair and effective asylum procedures. It also finances related EU-level action.

The co-financing from the Fund includes member states' actions such as improvements to accommodation infrastructure, integration of persons whose stay in the territory of a member state is prolonged and stable, training to ensure access to asylum procedures, legal and social assistance, etc.

The amending decision introduces six EU resettlement priorities for 2013, which include refugees and displaced persons in the following regions:

- Congolese refugees in the Great Lakes Region (Burundi, Malawi, Rwanda and Zambia);
- Refugees from Iraq in Turkey, Syria, Lebanon and Jordan;
- Afghan refugees in Turkey, Pakistan and Iran;
- Somali refugees in Ethiopia;
- Burmese refugees in Bangladesh, Malaysia and Thailand;
- Eritrean refugees in Eastern Sudan.

To make the planning of expenditure from the European Refugee Fund easier for the Commission, member states are asked to provide plans by 1 May this year, indicating how many refugees per priority group they plan to resettle in 2013.

These changes are part of broader revisions of the European Refugee Fund, which are being discussed by the Council and the European Parliament for the new EU financial perspective 2014-20.
Council of the European Union (http://www.consilium.europa.eu/homepage/showfocus?lang=en&focusID=81202) 9.3.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.04.2012, 11:03:21
Asylum Policy in the EU: The Case for Deeper Integration (http://econpapers.repec.org/paper/norwpaper/2012016.htm)

Liberaali eliitti haluaa siirtää turvapaikkapolitiikasta päättämisen EU:lle kampittaakseen maahanmuuttokysymyksellä ratsastavan äärioikeiston. Tai sitten päätösvalta halutaan siirtää EU:lle, jotta turvapaikkasääntöjä voidaan kiristää ilman oikeusistuimien ja muiden kansallisten toimijoiden napinaa.

Lainaus
These observations suggest that mainstream political parties, led by liberal-minded elites,
might be willing to cede control over asylum to the EU in order to take some of the heat out
of domestic politics and deflect pressure from the far right.
But one strand of the literature
argues exactly the opposite. It suggests instead that national governments are constrained
by domestic institutions (such as the courts) that uphold the legal rights of asylum seekers
and that prevent them from implementing asylum policies that are even tougher and more
exclusionary
. An alternative is to shift the locus of policy-making to the EU where national
governments are influential relative to liberal EU institutions and where there is less
external scrutiny. This presents the opportunity to sidestep domestic constraints, achieving
national policy objectives at the expense of national sovereignty.

Perustettaessa vaarattoman tuntuiset mutta myöhemmin vahvistettavat väliaikaisen suojelun direktiivi, Euroopan pakolaisrahasto ja EASO ovat osia Troijan hevosessa, jonka avulla luodaan "taakanjakoon" perustuva EU:n yhteinen, keskusjohtoinen turvapaikkajärjestelmä ilman varsinaista keskustelua ja päätöstä sen ominaisuuksista.

Lainaus
Perhaps more important is
the momentum that has been built over the last decade and that is being carried forward
under in the Stockholm Programme. As Luedtke (2009) points out, “creeping jurisdiction”
works in the Commission’s favour. Having established a legal basis it is possible later to
upgrade it—as with the Reception and Qualification Directives. Thus, initially anaemic
frameworks such as the Temporary Protection Directive, the ERF and EASO could provide
the foundation on which to build a much stronger element of burden-sharing into CEAS.

Lainaus
In the past decade harmonisation in asylum policy seems to have had the sorts of effects
that are predicted by the model. But to fully internalise the public good element deeper
integration would be necessary.
Although the establishment of EASO is an important step
forward, providing assistance, advice and logistical support does not constitute taking
control of asylum policy. A truly European asylum policy would require deeper
harmonisation of procedures and standards across the whole range of asylum policies
(some of which is in progress), as well as a stronger monitoring system. More importantly it
would require a centrally operated burden-sharing mechanism including a formula for
redistributing asylum applications that would replace the Dublin Regulation, the logistics of
which are already in place. One model would be to establish an EU-financed EASO ‘cell’ in
each country so that centrally determined policy could be implemented through existing
administrative structures.

Lainaus
Conclusion

This paper has examined the question of joint asylum policy within the EU from a number of
angles. The key conclusions can be summarised as follows:

- The theoretical foundation for cooperation among host countries over asylum policy
rests on the notion that refugees can be seen as a public good. In a framework with
public good effects cooperative policy making can, in principle, produce socially
optimal asylum policies, whereas independent national policy-making cannot
.

- Harmonisation alters the policies of individual countries but harmonisation makes it
impossible to reach the social optimum in the absence of some form of burden-
sharing
, either through a common financial pool or through refugee transfers.

- The Common European Asylum System has developed largely through policy
harmonisation with only a small burden-sharing element.

- The pattern of asylum applications remains highly unbalanced between countries,
something that existing policies have failed to address.

- Public opinion towards asylum policy was on balance negative in 2002/3. At the
individual level negative attitudes are associated with economic position, political
affiliation and cultural attitudes.

- Despite this, a surprisingly large proportion of voters would prefer to see asylum and
immigration policies set at the supra-national level
.

- Tougher national asylum polices have been associated with increases in the salience
of asylum and with electoral gains by far right parties. But despite some views to the
contrary, harmonisation has not simply been a race to the bottom.

- Recent trends within the EU suggest not only that a more centralised policy could
attain something closer to the social optimum but that such an outcome could
become politically feasible
in the foreseeable future.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: AIP - 24.04.2012, 12:41:05
Liberaali eliitti haluaa siirtää turvapaikkapolitiikasta päättämisen EU:lle kampittaakseen maahanmuuttokysymyksellä ratsastavan äärioikeiston. Tai sitten päätösvalta halutaan siirtää EU:lle, jotta turvapaikkasääntöjä voidaan kiristää ilman oikeusistuimien ja muiden kansallisten toimijoiden napinaa.

Tarjoaa muuten vanhoille puolueille hyvän mahdollisuuden käyttää populismia ääntenkalasteluun. Voivat alkaa ns. lievästi maahanmuuttokriittisiksi ilman että lupauksia tarvitsee lunastaa, koska EU ja kansainväliset sopimukset.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 04.05.2012, 14:17:14
Komissaari Cecilia Malmströmin Harvardin yliopistossa pitämä puhe summaa hyvin, mikä on vialla hänen ajamassaan EU:n maahanmuuttopolitiikassa. Kaikki.

Lainaus
Lecture at Harvard University's Minda de Gunzburg Center for European Studies

Boston, 30 April 2012

1. Introduction

I am delighted to be here with you and meet such a sophisticated audience to talk about a number of key challenges facing the European Union.

I am really impressed by the great attention paid to Europe at Harvard and am especially happy to be part of the Kokkalis program working so closely with the Centre of European Studies. Socrates Kokkalis's vision of helping new generations foster a peaceful and democratic future as well as develop open and prosperous societies, appeals to me greatly.

Today, I would like to focus on 3 key challenges for the EU:

The first is how to respond to the Arab Spring. Following the historic developments in the Arab world, the EU will need to bring about a serious change in its policies towards its Mediterranean neighbours.

The second challenge is the need for a common European migration policy. The EU is facing a declining labour force and needs to attract the rights skills and talent.

And the third challenge is the need for a common European asylum policy. The EU must ensure equal treatment of asylum seekers no matter where they apply and make sure all Member States shoulder their share of responsibility.

I will look at the possibilities of meeting these challenges in our globalizing world, amidst serious socio-economic circumstances and in a difficult political climate in Europe with increasing populism and rising nationalism.

[...]
Cecilia Malmström: Responding to the Arab Spring and rising populism: The challenges of building a European migration and asylum policy (http://europa.eu/rapid/pressReleasesAction.do?reference=SPEECH/12/312&type=HTML) 30.4.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 26.05.2012, 10:59:30
Britanniassa valmistaudutaan EU:n sisäisen pakolaisuuden räjähdykseen ja laittomien maassanotkujien olo pyritään tekemään mahdollisimman epämiellyttäväksi.

2012-05-25 Telegraph: Theresa May: we'll stop migrants if euro collapses (http://www.telegraph.co.uk/news/uknews/immigration/9291493/Theresa-May-well-stop-migrants-if-euro-collapses.html)

The Government is drawing up plans for emergency immigration controls to curb an influx of Greeks and other European Union residents if the euro collapses, the Home Secretary discloses today.

The introduction of immigration controls within the EU would undermine a key part of the single market. However, it is allowed in “exceptional” circumstances under European law.

Theresa May interview: 'We’re going to give illegal migrants a really hostile reception’ (http://www.telegraph.co.uk/news/uknews/immigration/9291483/Theresa-May-interview-Were-going-to-give-illegal-migrants-a-really-hostile-reception.html)

“The aim is to create here in Britain a really hostile environment for illegal migration,” she declares. Work is under way to deny illegal immigrants access to work, housing and services, even bank accounts. “What we don’t want is a situation where people think that they can come here and overstay because they’re able to access everything they need,” she says.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 31.05.2012, 19:35:28
Lainaus
MIETINTÖLUONNOS

23.5.2012

EU:n sisäisen solidaarisuuden lisäämisestä turvapaikka-asioissa (2012/2032(INI))
Kansalaisvapauksien sekä oikeus- ja sisäasioiden valiokunta
Valmistelija: Kyriacos Triantaphyllides
...

1. suhtautuu myönteisesti komission tiedonantoon "EU:n sisäisen solidaarisuuden lisääminen
turvapaikka-asioissa", jossa vaaditaan solidaarisuuden ja vastuun jakamisen idean
muuttamista konkreettisiksi toimiksi;
...

3. vakuuttaa, ettei solidaarisuuden periaate koske vain jäsenvaltioiden keskinäisiä suhteita,
vaan kattaa myös turvapaikanhakijat ja kansainvälistä suojelua saavat henkilöt;
...

5. painottaa, että turvapaikanhakijoiden ja kansainvälistä suojelua saavien henkilöiden
suojelun korkeaa tasoa ei voida saavuttaa, jos eri jäsenvaltioiden välisiä eroja
turvapaikkahakemusten osuuksissa ja teknisissä ja hallinnollissa valmiuksissa ei tasoiteta;
...

7. toteaa, että EU:n ulkorajavaltioiden saama tuki niitä toimenpiteitä varten, joita niiden
odotetaan toteuttavan Euroopan yhteisen turvapaikkajärjestelmän mukaisesti, ei vielä
läheskään riitä;
...

9. pitää valitettavana sitä, että muukalaisviha ja rasismi sekä turvapaikanhakijoita ja
pakolaisia koskevat kielteiset ja väärään tietoon perustuvat käsitykset ovat saaneet yhä
enemmän jalansijaa EU:ssa; suosittelee, että jäsenvaltiot toteuttaisivat
turvapaikanhakijoiden ja kansainvälistä suojelua saavien henkilöiden todellista tilannetta
koskevia tiedotuskampanjoita;
...

10. korostaa, että perustamalla Euroopan turvapaikka-asioiden tukivirasto (EASO) voidaan
tiivistää turvapaikkakäytäntöjen välisten huomattavien erojen tasaamiseen tähtäävää
jäsenvaltioiden välistä yhteistyötä ja parantaa turvapaikkajärjestelmien toimivuutta ja
oikeudenmukaisuutta EU:ssa;
...

14. suhtautuu myönteisesti vuonna 2014 perustettavaksi suunniteltuun turvapaikka- ja
maahanmuuttorahastoon ja korostaa, että kansainvälistä suojelua saavien henkilöiden ja
turvapaikanhakijoiden suojeluun on osoitettava runsaasti ja riittävästi resursseja;
...

17. korostaa taloudellisen vastuun jakamisen tärkeyttä turvapaikka-asioissa ja suosittelee, että
luotaisiin runsasrahoitteinen mekanismi, josta maksettaisiin korvauksia niille
jäsenvaltioille, joiden vastaanottamien turvapaikanhakijoiden ja kansainvälistä suojelua
saavien henkilöiden määrä on absoluuttisesti tai suhteellisesti suurempi kuin muissa
jäsenvaltioissa, ja josta avustettaisiin jäsenvaltioita, joiden turvapaikkajärjestelmät ovat
puutteelliset;
...

21. katsoo, että Dublin-asetuksella, jossa säädetään turvapaikkahakemuksia koskevan vastuun
jakamisesta, sälytetään kohtuuton taakka EU:hun tulopisteinä toimiville jäsenvaltioille
tarjoamatta niille keinoja selviytyä asiaan liittyvistä hallinnollisista ja taloudellisista
vaatimuksista; toteaa, että tähän mennessä sovellettu Dublin-järjestelmä on johtanut
turvapaikanhakijoiden eriarvoiseen kohteluun EU:ssa ja aiheuttanut haittaa
perheenyhdistämiselle ja kotoutumiselle;
...

23. katsoo, että on välttämätöntä jatkaa vuoropuhelua turvapaikanhakijoita ja kansainvälistä
suojelua saavia henkilöitä koskevan vastuun jakamisesta sekä vuoropuhelua
suojelunormien parantamista edistävien välineiden, kuten turvapaikkahakemusten
yhteiskäsittelyn, (jäljempänä "yhteiskäsittely") ja uudelleensijoittamista koskevien
ohjelmien, käyttämisestä;
...

28. korostaa, että kansainvälistä suojelua saavien henkilöiden ja turvapaikanhakijoiden
uudelleensijoittaminen voi tietyin edellytyksin olla yksi konkreettisimmista
solidaarisuuden muodoista, ja että sillä voidaan edesauttaa merkittävästi tasapuolisemman
Euroopan yhteisen turvapaikkajärjestelmän luomista;
...

30. kehottaa komissiota sisällyttämään ehdotukseensa EU:n pysyvästä uudelleensijoittamista
koskevasta ohjelmasta vahvat menettelylliset takeet ja selkeät kriteerit, joilla pyritään
takaamaan suojelua mahdollisesti saavien henkilöiden etujen noudattaminen; suosittelee
vastaanottavan yhteisön, kansalaisyhteiskunnan ja paikallisviranomaisten ottamista alusta
alkaen mukaan uudelleensijoittamisaloitteisiin;
...

37. painottaa, että maahanmuuton hallinta voi parantaa keskinäistä luottamusta ja
solidaarisuustoimenpiteitä vain, jos se yhdistetään suojelulähtöiseen lähestymistapaan,
jonka perusteella rajamenettelyt toteutetaan rajoittamatta pakolaisten ja kansainvälistä
suojelua pyytävien henkilöiden oikeuksia;
...

38. toteaa, että rajoittavilla viisumijärjestelmillä ja tehostetuilla rajatarkastuksilla voi olla
kielteisiä vaikutuksia kansainvälisen suojelun saamiseen, koska ne estävät hädässä olevia
henkilöitä pääsemästä EU:hun;
...

Esittelijän mielestä tehokkaassa Euroopan yhteisessä turvapaikkajärjestelmässä
- jäsenvaltioille, paikallisviranomaisille ja kansalaisyhteiskunnalle olisi annettava tietoja
erilaisista EU:n rahastoista, joita voidaan käyttää turvapaikkoihin liittyvissä asioissa, kuten
kelpoisuusvaatimuksia ja hakumenettelyjä koskevia tietoja;
- jäsenvaltioiden turvapaikkajärjestelmiä olisi arvioitava säännöllisesti ja usein sekä parhaiden
toimintatapojen että puutteiden tunnistamiseksi ja kohdennettujen tapauskohtaisten
ratkaisujen löytämiseksi;
- jäsenvaltioiden olisi osoitettava keskinäistä solidaarisuutta toisilleen ja jaettava vastuuta
esimerkiksi myös turvapaikkahakemusten yhteiskäsittelyn ja kansainvälistä suojelua saavien
henkilöiden uudelleensijoittamisen kautta.
...

Tämän päätöslauselman jokaisella ehdotuksella ja suosituksella pyritään luomaan todellinen
suojelun alue, jolla turvapaikanhakijoiden ja kansainvälistä suojelua saavien henkilöiden
oikeuksia kunnioitetaan ja edistetään asianmukaisesti. Osa ehdotuksista on näin ollen
horisontaalisia ja liittyy myös muihin EU:n politiikan aloihin, kuten raja- tai
viisumipolitiikkaan, koska kaikkien EU:n politiikkojen soveltamisessa on noudatettava
suojelulähtöisyyden periaatetta.

Euroopan parlamentti (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-%2f%2fEP%2f%2fNONSGML%2bCOMPARL%2bPE-489.453%2b02%2bDOC%2bPDF%2bV0%2f%2fFI)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: randomi7 - 31.05.2012, 20:00:12

Lainaus
38. toteaa, että rajoittavilla viisumijärjestelmillä ja tehostetuilla rajatarkastuksilla voi olla
kielteisiä vaikutuksia kansainvälisen suojelun saamiseen, koska ne estävät hädässä olevia
henkilöitä pääsemästä EU:hun;
Jaa että rajat auki vaan afrikkalaisille ym. ?  8)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 31.05.2012, 20:52:19

Lainaus
38. toteaa, että rajoittavilla viisumijärjestelmillä ja tehostetuilla rajatarkastuksilla voi olla
kielteisiä vaikutuksia kansainvälisen suojelun saamiseen, koska ne estävät hädässä olevia
henkilöitä pääsemästä EU:hun;
Jaa että rajat auki vaan afrikkalaisille ym. ?  8)

No just. Harras muslimi ei ainakaan voi olla hädässä, koska allah huolehtii omistaan, vai mitä muslimit? Ai ei huolehdi vai? tu mikä...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.06.2012, 12:36:28
Lainaus
EU Common Asylum System to be completed by 2012

The Commission pursues the completion of the Common European Asylum System (CEAS) by 2012. The modified proposals on the Reception Conditions and the Asylum Procedures Directives will ensure faster, fairer and more efficient rules to the benefit of Member States and people seeking international protection. They take account of the lessons learnt from several years of negotiations in the Council of Ministers and in the European Parliament, as well as from consultations with refugee associations and the UNHCR. Negotiations must now move ahead on the remaining elements of the 'asylum legislative package'.

"The consolidation of a genuine common immigration and asylum policy is one of my top priorities. Today the level of treatment and guarantees for asylum seekers varies widely across the EU, and the chances of obtaining protection are radically different depending on which Member State examines the asylum request. This must change. We need efficient and fair asylum procedures and adequate and comparable reception conditions for asylum seekers throughout the EU. At the same time, the standards we agree at the European level should be simple, clear, and cost-efficient. The EU must stand up for its values and provide protection for those coming here to seek refuge from persecution and conflict - that is why we must respect our commitment to establish a Common European Asylum System by 2012. Today's proposals offer high level standards for people genuinely in need of protection, and will help to reduce unnecessary burdens on national authorities. They will also contribute to building more trust between the Member States", said Cecilia Malmström, Commissioner for Home Affairs.
CTA (http://brussels.cta.int/index.php?option=com_k2&view=item&id=5641:eu-common-asylum-system-to-be-completed-by-2012) 5.6.2012

Lainaus
"The figures of the Report and the result of the opinion poll support the Commission's view that the European Union needs a strong and coherent migration policy, responding both to short term and long term needs. We need to effectively manage our external borders, to safeguard free movement within the EU, to provide genuine protection to those in need whilst at the same time providing channels for legal migration and mobility", said Cecilia Malmström, Commissioner for Home Affairs.
New report and survey give a snapshot of migration, asylum and free movement in the EU (http://europa.eu/rapid/pressReleasesAction.do?reference=IP/12/552&format=HTML&aged=0&language=EN&guiLanguage=en) 1.6.2012

Lainaus
Just over four in ten Europeans (42%) think the EU should encourage labour
migration from non-EU countries to help tackle demographic challenges and
labour shortages within the EU, with a slightly higher proportion (46%)
disagreeing.
Lainaus
Respondents in Sweden (60%) and Finland (56%) are most likely to think the EU
should encourage migration from non-EU countries
and those in Latvia (18%) and
Cyprus (16%) least likely to do so.
Lainaus
Only a third of Europeans (34%) believe that discussion about immigration in the
EU is based on facts and reliable data.
A slightly higher proportion (40%) take the
opposing view and one in four (26%) are not sure either way.
Lainaus
Respondents in NMS12 (40%) are somewhat more likely than those in EU15
(32%) to think that discussion about immigration in the EU is based on reliable
information. Countries where the belief that discussion is based on reliable data is
most widespread are
Poland (47%), Lithuania (46%), Estonia and Finland (both
45%) and Luxembourg and Belgium (both 44%). Those where the most
widespread view is that discussion is not based on reliable information are
Sweden (59%)
, the UK and the Netherlands (both 56%), Greece (54%), and
Denmark (51%).
Lainaus
Most Europeans also agree that the costs associated with the provision of asylum
should be shared between all Member States (81%) and that the number of
asylum seekers should be shared more equally across Member States (80%)
.
Special Eurobarometer 380: Awareness of home affairs (http://ec.europa.eu/public_opinion/archives/ebs/ebs_380_en.pdf) 1.6.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: matkamasentaja - 06.06.2012, 09:39:35

Lainaus
38. toteaa, että rajoittavilla viisumijärjestelmillä ja tehostetuilla rajatarkastuksilla voi olla
kielteisiä vaikutuksia kansainvälisen suojelun saamiseen, koska ne estävät hädässä olevia
henkilöitä pääsemästä EU:hun;
Jaa että rajat auki vaan afrikkalaisille ym. ?  8)

No just. Harras muslimi ei ainakaan voi olla hädässä, koska allah huolehtii omistaan, vai mitä muslimit? Ai ei huolehdi vai? tu mikä...



Eikä huonosti menemisestä voi valittaa koska se on Allahin tahto, ennalta määrätty kohtalo tapahtumaan ja siksi mulkulle ko. tyypille aivan oikein.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Näkkileipä - 07.06.2012, 16:00:01
Lainaus
MIETINTÖLUONNOS

23.5.2012

38. toteaa, että rajoittavilla viisumijärjestelmillä ja tehostetuilla rajatarkastuksilla voi olla
kielteisiä vaikutuksia kansainvälisen suojelun saamiseen, koska ne estävät hädässä olevia
henkilöitä pääsemästä EU:hun;

Euroopan parlamentti (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-%2f%2fEP%2f%2fNONSGML%2bCOMPARL%2bPE-489.453%2b02%2bDOC%2bPDF%2bV0%2f%2fFI)
Eikö kukaan näistä äärisuvaitsevaisista, mieti koskaan Miksi "hädässä olevat henkilöt" eivät pysähdy, ensimmäiseen turvalliseen EU-maahan? Vaan matkustavat Suomeen, joka taitaa olla kaukaisin EU-maa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.06.2012, 11:42:35
Komissaari Malmströmin linjauksia alkuviikosta Haagissa pitämässään puheessa:
Lainaus
Ladies and gentlemen,

I'm pleased to be here with you today to talk about the future of global migration, which is set to be one of the defining issues of this century.

Our response to the challenges of global migration will either make us stronger - economically, culturally, and morally - or it will make us weaker, leading to heightened social tensions and economic decline.

Despite the anti-immigrant rhetoric that has emerged during the economic crisis, we must see migration as an opportunity, not a threat.

It won't be long before we start to feel the impact of our ageing population and declining labour force. Many countries, including within the EU, will soon be confronted with a serious lack of skills and talent.

Many countries cannot meet their labour needs with a purely home-grown workforce. Global economic integration is deepening. The breadth of skills needed to drive innovation is expanding. And this means that the need for a mobile global workforce will increase.

The EU's working age population will shrink by 12 per cent by 2030 without net migration. The EU will be short of an estimated 380,000 to 700,000 IT workers in 2015. And by 2020, the health sector could be short of two million professionals.

Even today, when unemployment is exceptionally high in some parts of Europe, many countries are already facing labour and skills shortages in certain sectors.

[...]

It is more important than ever for us to stand up against the rising tide of anti-immigrant rhetoric.

Unscrupulous politicians have been quick to recognise and exploit people's fears, blaming migrants for our economic woes. Their mantra will be familiar to most of you: "migrants are coming over here, taking our jobs, forcing down our wages and exploiting our welfare systems".

This statement is alarmist, misleading and wrong. It is the worst kind of politics, exploiting people's insecurities and worries about the future.

The proposed solutions are simplistic, ill-thought out and simply unworkable.

We must counter such assertions with facts. And we must recognise that reliable evidence is the best defence.

We must use the evidence to show that immigrants are not 'stealing' jobs from native-born workers.

We must show that well-designed migration policies are not driving down the wages of native workers.

And we must make clear that migrants generally pay more in taxes than they receive from the state. They are not a structural burden on the overall public welfare system.

The bottom line is that migration stimulates and sustains economic growth. Migrants should not be unjustly blamed for society's ills.

This is the message that we must promote.

[...]

The EU recently adopted a resettlement program and I very much hope this will allow us to place a more active role in providing international protection for those in need. I also intend to further promote the Regional Protection programs in close cooperation with the UNHCR.

Our neighbours will of course get special attention.

In 2011, the EU missed a historic opportunity to show North African countries and the world that it was committed to defending the fundamental values upon which it was built.

Instead of helping these countries and giving protection to those in need, the EU was too concerned with security matters and simply closed its borders. It's as if we said "It's wonderful that you've started a revolution and want to embrace democracy, but we have an economic crisis to deal with so we can't help".

I hope that the EU will not miss the opportunity that still lies before us. The Arab Spring is still in its early stages.
Cecilia Malmström European Commissioner responsible for Home Affairs Migration is an opportunity, not a threat Global Hearing on refugees and Migration /Hague 5 June 2012  (http://europa.eu/rapid/pressReleasesAction.do?reference=SPEECH/12/417&format=HTML&aged=0&language=EN&guiLanguage=en)

upi.com: EU leader: Immigration not a threat (http://www.upi.com/Top_News/Special/2012/06/07/EU-leader-Immigration-not-a-threat/UPI-16301339065000/) 7.6.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: TheJ - 08.06.2012, 11:48:16
Siinäpä taas nähdään että koko massamaahanmuuttokuvio on oikeasti taustalla hääräävien pankkiirien etujen ajamisen vuoksi tehty himmeli.

Velkapyramidit eivät pysy pystyssä ellei talous jatkuvasti kasva. Talouskasvulle on huono juttu jos työssäkäyvien määrä väestöstä laskee. Sen sijaan että yhteiskunta ja talous sopeutuisi tilanteeseen jossa väestönkasvu pysähtyy (hyvä tämän pallon kantokyvylle), yritetään pää märkänä saada jotenkin sitä kuuluisaa talouskasvua jotta velkavuoret voitaisiin joskus maksaa.

...paitsi että jostain syystä tällä tavalla saadaan Eurooppaan vain läjäpäin sosiaaliturvaa kuormittavaa jengiä jolle tärkeintä tuntuu olevan lisääntyminen ja Mekkaan päin kumartelu. Joo, väestö saadaan näin edelleen kasvamaan mutta talouden kanssa voi olla vähän heikommin...

Täysin pähkähullua toimintaa.

Lainaus


The proposed solutions are simplistic, ill-thought out and simply unworkable.

We must counter such assertions with facts. And we must recognise that reliable evidence is the best defence.

We must use the evidence to show that immigrants are not 'stealing' jobs from native-born workers.

We must show that well-designed migration policies are not driving down the wages of native workers.

And we must make clear that migrants generally pay more in taxes than they receive from the state. They are not a structural burden on the overall public welfare system.

The bottom line is that migration stimulates and sustains economic growth. Migrants should not be unjustly blamed for society's ills.

This is the message that we must promote.

Niiih. Tätä viestiä tulee rummuttaa. Sitä ei tarvitse perustella mitenkään koska faktat täsmäävät huonosti (joten jätetään ne perustelut pois tästä), mutta tämä on nyt se viesti joka pitää kertoa kansalle. Toimikaa!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.06.2012, 16:47:36
Euroopan unionin virallinen lehti (http://eur-lex.europa.eu/LexUriServ/LexUriServ.do?uri=OJ:C:2012:191:0134:0141:FI:PDF) 29.6.2012

Lainaus
Euroopan talous- ja sosiaalikomitean lausunto aiheesta ”Komission tiedonanto Euroopan
parlamentille, neuvostolle, Euroopan talous- ja sosiaalikomitealle ja alueiden komitealle –
Maahanmuuttoa ja liikkuvuutta koskeva kokonaisvaltainen lähestymistapa”


...

1.11
Jotta vältetään maastamuuton kielteiset vaikutukset läh­tömaiden talous- ja yhteiskuntakehitykseen, Euroopan unionin on kiinnitettävä huomiota varsinkin aivovuodon kielteisiin vai­kutuksiin ja luotava tasapainottamismekanismeja.

...

1.14
EU:lla on oltava avoin maahanmuuttajien maahanpääsypolitiikka, jossa noudatetaan keskipitkän aikavälin lähestymis­tapaa nykyisestä talouskriisistä riippumatta ja jossa otetaan huomioon väestörakenne. Työvoimaperäiseen maahanmuuttoon liit­tyvien menettelyiden tulee olla laillisia ja avoimia, ja EU:n ja lähtömaiden työmarkkinaosapuolten yhteistyötä on edistettävä.

...

1.16
Liikkuvuuskumppanuuksissa tulee ottaa huomioon, että palauttamismenettelyissä käytetään ensisijaisesti vapaaehtoista paluuta, johon liittyy tukijärjestelmiä. Kun poikkeuksellisesti toteutetaan pakkokeinoihin perustuvia palauttamismenettelyitä, henkilöiden ihmisoikeuksia on kunnioitettava täysimääräisesti ja ottaen huomioon Euroopan neuvoston suositukset.

1.17
ETSK toivoo, että EU:lle luotaisiin yhteinen turvapaik­kajärjestelmä, johon kuuluisi pitkälle yhdenmukaistettu lainsää­däntö. Komitea tukee myös EU:n tekemää yhteistyötä sen ulkopuolisten maiden kanssa, jotta nämä parantaisivat turvapaikka­järjestelmiään ja täyttäisivät paremmin kansainväliset normit. EU:n ja sen ulkopuolisten maiden välisiin sopimuksiin tulee sisällyttää menettelyitä, jotka takaavat tosiasiallisen oikeuden kansainväliseen suojeluun henkilöille, jotka sitä pyytävät.

...

1.19
EU:n on vahvistettava kotouttamispolitiikkoja ja torjut­tava entistä voimakkaammin rasismia, muukalaisvihaa sekä maahanmuuttajiin ja vähemmistöihin kohdistuvaa syrjintää. Ko­mitea kehottaa EU:n toimielimiä toimimaan erittäin aktiivisesti muukalaisvihan, rasismin ja syrjinnän torjumiseksi erityisesti sil­loin, kun jäsenvaltioiden päättäjät ja lainsäätäjät edistävät täl­laista käyttäytymistä.

1.20
ETSK jatkaa yhteistyössä Euroopan komission kanssa Euroopan kotouttamisfoorumin toiminnan tukemista, sillä ko­mitean mielestä kotouttaminen on tulevina vuosina strateginen haaste EU:n, maahanmuuttajataustaisten henkilöiden ja kaikkien kansalaisten edun kannalta.

...

2.7
Viime vuosien aikana Euroopan unionin yhteistä siirto­lais- ja turvapaikkapolitiikkaa on kehitetty, mutta lainsäädännöl­liset ja poliittiset välineet ovat edelleen riittämättömiä. Jäsenval­tioilla on omat politiikkansa, jotka ovat ajoittain ristiriidassa unionin painopistealojen ja sopimusten kanssa. ETSK kehottaa­kin kaikkia jäsenvaltioita sitoutumaan yhteiseen politiikkaan, joka on määritelty perussopimuksissa ja Tukholman ohjelmassa.

2.8
Painopisteen on oltava keskipitkällä aikavälillä, sillä tä­mänhetkisestä talouskriisistä ja työttömyyden lisääntymisestä huolimatta EU tarvitsee avoimempaa uusien siirtotyöläisten maahanpääsypolitiikkaa, kuten ETSK on todennut EU:n silloisen puheenjohtajavaltion Belgian pyytämässä valmistelevassa lausun­nossa ”Laillisen maahanmuuton rooli väestönkehityksen aiheut­tamiin haasteisiin vastaamisessa”. Myös komissio toteaa tie­donannossaan, että uusien siirtolaisten tuleminen on tarpeen väestökehityksen ja työmarkkinoiden näkökulmasta.

2.9
ETSK katsoo, että EU ei voi vastata uusiin haasteisiin rajoittavalla ja epäyhtenäisellä maahanmuuttopolitiikalla, jollaista jäsenvaltiot ovat aikaisemmin noudattaneet. EU:n maahanmuut­topolitiikan on päästävä eroon vanhoista rajoituksista ja sopeu­duttava tämänhetkisiin vaatimuksiin.

...

3.6
ETSK toistaa aiemmissa lausunnoissaan esittämänsä eh­dotuksen siitä, että järjestelmiä siirtotyöläisten tutkintojen, tut­kintotodistusten ja taitojen tunnustamiseksi tulisi parantaa ja ne tulisi sisällyttää liikkuvuuskumppanuuksiin.

3.7
Kuten komitea on ehdottanut aiemmissa lausunnoissaan, maahanmuuttajille olisi taattava tehokkaalla tavalla sosiaaliturva­oikeuksien siirtomahdollisuus lähtömaiden ja EU:n välillä. Tä­män vuoksi sosiaaliturva-asiat on sisällytettävä liikkuvuuskump­panuuksiin. Vaikka eurooppalaisissa maahanmuuttolainsäädän­nöissä rajoitetaan sosiaaliturvaoikeuksia, näillä sopimuksilla pys­tytään ratkaisemaan monia ongelmia. Tämä on taas yksi syy tehdä liikkuvuuskumppanuuksista oikeudellisesti sitovia välineitä.

3.8
ETSK korostaa kotouttamispolitiikkojen merkitystä. Ko­mitea haluaa voimakkaasti edistää kotouttamista ja kansalais­yhteiskunnan organisaatioiden roolia siinä. ETSK:n tiloissa puo­len vuoden välein järjestettävä Euroopan kotouttamisfoorumi on erittäin tärkeä väline EU:n toimielimille. Euroopan kotouttamis­rahasto on keskeinen rahoitusväline, jota tulee laajentaa.

...

3.12
Komitea on ehdottanut perheen yhdistämistä koskevan direktiivin muuttamista, koska se on tällä hetkellä riittämätön. Komissio on laatinut asiasta vihreän kirjan, josta komitea val­mistelee parhaillaan lausuntoa.

3.13
Komitea on seurannut viime vuosien tapahtumia, julis­tuksia ja poliittisia päätöksiä erittäin huolestuneena, sillä eu­rooppalaisten keskuudessa valtaa jälleen alaa vanha tuttu vitsaus: muukalaisviha ja ehdoton nationalismi. Vähemmistöjä ja maa­hanmuuttajia kohdellaan halventavasti, ja he joutuvat herjausten sekä aggressiivisten ja syrjivien politiikkojen kohteeksi.

3.14
Aiemmin muukalaisvihaa ja populismia edistivät ainoas­taan poliittiset ääriryhmät, jotka olivat kuitenkin vähemmistössä. Nykyisin tällaiset politiikat ovat kuitenkin osa joidenkin halli­tusten asialistaa ja ohjelmia, ja nämä hallitukset käyttävät maa­hanmuuttajien ja vähemmistöjen vastaisia politiikkoja vaaliasee­naan. ETSK kehottaa EU:n toimielimiä estämään muukalaisvihaa ja populismia likaamasta EU:n asialistaa.

...

4.7
ETSK on todennut jo useissa lausunnoissaan, että laillisen ja laittoman maahanmuuton välillä on selkeä yhteys, sillä laiton maahanmuutto lisääntyy silloin, kun lailliseen maa­hanmuuttoon ei ole riittäviä, avoimia ja joustavia mahdollisuuk­sia.

...

4.10
Mitä tulee sääntöjen vastaisesti maassa oleskelevien siir­tolaisten säilöönottoon, komitea jakaa komission näkemyksen siitä, että ”olisi myös ryhdyttävä toimenpiteisiin sen varmistami­seksi, että maahanmuuttajilla on kunnolliset elinolosuhteet vas­taanottokeskuksissa ja että vältetään mielivaltaista tai määrää­mättömän ajan kestävää säilöönottoa”. ETSK katsoo, että hallinnollisesti sääntöjen vastaisessa tilanteessa olevat henkilöt eivät ole rikollisia. Komitea pahoitteleekin, että joissakin kansal­lisissa toimissa on väärinkäytetty palauttamisdirektiiviä, jota tu­lisi komitean mielestä muuttaa siten, että perusoikeuksia suojel­laan asianmukaisesti.

...

5.1
Turvapaikanhakijat eivät useinkaan pysty hakemaan tur­vapaikkaa EU:n alueella, koska laittoman maahanmuuton tor­juntaa varten perustetut valvontarakenteet estävät heidän pääsynsä unionin alueelle. Laittoman maahanmuuton torjumiseen käytettävät keinot ovatkin räikeästi ristiriidassa turvapaikkaoike­uden kanssa.

...

5.3
Komitea tukee komission työtä EU:n turvapaikkalainsää­dännön parantamiseksi; sen tuloksena tulee olla pitkälle yh­denmukaistettu lainsäädäntö, turvapaikan saaneiden yhdenmu­kainen asema sekä avoimet ja tehokkaat menettelyt. EU:ssa suo­jelun alaisina olevien henkilöiden ja turvapaikanhakijoiden on kyettävä pääsemään työmarkkinoille tasavertaisin ehdoin.

...

5.7
Liikkuvuuskumppanuudet eivät saa johtaa siihen, että kumppanuusmaat joutuvat vastaamaan niiden alueen kautta kul­kevien henkilöiden turvapaikkamenettelyiden kaikista kustan­nuksista. EU:n on annettava apua turvapaikkarahastojen kautta.

5.8
EU:n on jatkossakin vastaanotettava maahanmuuttajia ja pystyttävä tarjoamaan turvapaikka sitä tarvitseville. Jäsenvaltioi­den välistä solidaarisuutta on vahvistettava ja uudelleensijoitta­misohjelmia on lisättävä.

...

6.5
EU:n on luotava korvaavia järjestelmiä maille, jotka Eu­rooppaan kohdistuvan muuttoliikkeen vuoksi kärsivät henkisen pääoman menetyksestä. Hyvittävien toimien on sisällettävä muun muassa tukea koulutusjärjestelmille ja työmarkkinalaitok­sille työpaikkojen luomiseksi ja työolosuhteiden parantamiseksi.

Maahanmuuttoa EU-alueelle on lisättävä, mutta samalla sen kustannuksia on korotettava ja EU:n ulkopuolisille lähtömaille on maksettava korvauksia menetetystä henkisestä pääomasta. Mitäpä siitä, että esimerkiksi Suomi on itse aivovuotomaa. Näillä eväillä kohti Euroopan yhteistä maahanmuutto- ja turvapaikkapolitiikkaa ja sitten Euroopan liittovaltiota.

Hauska nähdä, että Euroopan talous- ja sosiaalikomitea jakaa Anni Sinnemäen käsityksen (http://fi.wikiquote.org/wiki/Anni_Sinnem%C3%A4ki), että laiton maahanmuutto johtuu lähinnä laillisten väylien puutteesta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Uuno Nuivanen - 29.06.2012, 17:02:49
"Muukalaisvihaa" vähennetään muukalaisia lisäämällä. Joopa joo.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Maisterinna - 29.06.2012, 18:15:34
Kiitos Roope. Hiljaiseksi vetää isä-EU:n julistus. Kohdat 3.14 ja 4.7 tuovat räikeästi mieleen diktatuurien propagandan.

Lainaus
Komitea on seurannut viime vuosien tapahtumia, julis­tuksia ja poliittisia päätöksiä erittäin huolestuneena, sillä eu­rooppalaisten keskuudessa valtaa jälleen alaa vanha tuttu vitsaus: muukalaisviha ja ehdoton nationalismi. Vähemmistöjä ja maa­hanmuuttajia kohdellaan halventavasti, ja he joutuvat herjausten sekä aggressiivisten ja syrjivien politiikkojen kohteeksi.


Kursivointi oma. Komitealta ilmeisesti on jäänyt huomaamatta lisääntynyt rikollisuus ja esimerkiksi toveri Ruotsin kohoaminen Euroopan johtavaksi raiskaustilastomaaksi (tekijöinä eivät Håkan ja Åke) ja minareettien kohoaminen Berliiniin sekä Pariisiin. Ettäs kehtaavat verrata näihin ilmiöihin reagointia natsismiin. Komitea on hyvä vaan ja selvittää EU-kansalaisten mielipiteet maahanmuuttoon. Lahjoitan koko omaisuuteni EU:n kotouttamisrahastoon, mikäli yli puolet EU-kansalaisista on sitä mieltä, että EU tarvitsee lisää turvapaikanhakijoita.

Lainaus
ETSK kehottaa EU:n toimielimiä estämään muukalaisvihaa ja populismia likaamasta EU:n asialistaa.


Mitä helvettiä?

---

Jos EU:n yhteiset turvapaikkamenettelyt toteutuvat, niin veikkaan että se räjäyttää pankin. Kun 20 000 aavikkokansan edustajaa astuu EU:n johdattamina Suomeen (ja lähtömaalle reilut korvaukset "menetyksestä"), roihahtavat mielenosoitukset Helsingissä .
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 14.07.2012, 23:52:13
Lainaus
Asylum policy: call for fair shares and solidarity

LIBE Asylum policy ? 11-07-2012 - 14:05
 
A permanent system for relocating internationally protected persons within the EU would help to improve asylum policy solidarity among EU member states, says a resolution voted by the Civil Liberties Committee on Tuesday. MEPs also call for more money for asylum policy, joint processing of asylum applications and a stronger role for the European Asylum Support Office (EASO), to promote closer cooperation among EU countries.

The committee calls on the Commission to include an "EU distribution key" for relocating beneficiaries of international protection in its legislative proposal for a permanent intra-EU relocation mechanism. The system would use objective indicators, such as member states' GDP, population, surface area and beneficiaries' best interests and integration prospects.

Including a such a "distribution key" could help EU countries facing disproportionate pressures on their national asylum systems or in emergency situations, say MEPs, who also call on the Commission to study the feasibility of an EU system for relocating asylum seekers.

"We have sent a strong signal to the Commission and to the member states on how we conceive solidarity in the field of asylum through concrete proposals to translate this principle into action. Our message is clear. Now the ball is in the Commission's court. We expect the Commission to come forward with legislative proposals because it is time to change the logic underlying the Common European Asylum System so as to base it on genuine and effective solidarity as well as fair responsibility sharing", commented rapporteur Kyriacos Triantaphyllides (GUE/NGL, CY), after the committee vote.

Joint processing system

Processing asylum applications jointly would enable member states to support each other at various stages of the asylum procedure, such as identifying applicants, preparing first-instance decisions, conducting interviews or making recommendations. However, the final decision on an asylum application would remain under the responsibility of the member states, points out the resolution.

Financial solidarity

MEPs want to allocate "sufficient and substantial resources" to the Asylum and Migration Fund, which should be "flexible and easy to mobilise" so as to respond to unforeseen pressures or emergencies. They also call for the creation of a "well-resourced mechanism" to compensate member states receiving higher numbers of asylum seekers and welcome the possibility of increasing Commission contributions to asylum projects.

Stronger role for the EASO

The EASO has "the potential to promote closer cooperation" among EU member states and to "help reduce the significant divergences in asylum practices", MEPs say. The resolution notes the agency's role "in coordinating and supporting common action" to assist countries which are subject to particular pressures. However, "the impact of the EASO will depend on the willingness of member states to make full use" of its potential, stresses the text.

Current asylum system review


The current review of today's asylum system should include further reflection "on the development of an equitable responsibility-sharing mechanism" for determining which member state is responsible for processing an asylum application, MEPs add.
Euroopan parlamentti/ajankohtaista (http://www.europarl.europa.eu/news/fi/pressroom/content/20120709IPR48499/html/Asylum-policy-call-for-fair-shares-and-solidarity) 11.7.2012

Euroopan parlamentin Kansalaisvapauksien sekä oikeus- ja sisäasioiden valiokunta LIBE hahmottelee EU:n yhteistä turvapaikkapolitiikkaa, jollaisesta se vaatii komissiolta lakiesitystä. Järjestelmässä pakolaiset jaettaisiin EU-maiden kesken "valtioiden BKT:n, asukasluvun, pinta-alan sekä pakolaisten edun ja integroitumisodotusten" mukaan. Jatkossa turvapaikkahakemukset käsiteltäisiin EU:ssa keskitetysti ja järjestelmään pitäisi pumpata EU:n pakolaisrahaston kautta "tarpeeksi ja merkittävästi resursseja".

"Aito ja tehokas solidaarisuus" sekä "reilu taakanjako" ovat valiokunnan mukaan EU:ssa kuuminta hottia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: randomi7 - 14.07.2012, 23:54:15
Lainaus
Euroopan parlamentin Kansalaisvapauksien sekä oikeus- ja sisäasioiden valiokunta LIBE hahmottelee EU:n yhteistä turvapaikkapolitiikkaa, jollaisesta se vaatii komissiolta lakiesitystä. Järjestelmässä pakolaiset jaettaisiin EU-maiden kesken "valtioiden BKT:n, asukasluvun, pinta-alan sekä pakolaisten edun ja integroitumisodotusten" mukaan. Jatkossa turvapaikkahakemukset käsiteltäisiin EU:ssa keskitetysti ja järjestelmään pitäisi pumpata EU:n pakolaisrahaston kautta "tarpeeksi ja merkittävästi resursseja".

"Aito ja tehokas solidaarisuus" sekä "reilu taakanjako" ovat valiokunnan mukaan EU:ssa kuuminta hottia.
Mitähän tuo käytännössä tarkottaisi, Suomeen tyyliin joku 50k pakolaista vuodessa?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vesisade - 14.07.2012, 23:59:20
Lainaus
Järjestelmässä pakolaiset jaettaisiin EU-maiden kesken "valtioiden BKT:n, asukasluvun, pinta-alan sekä pakolaisten edun ja integroitumisodotusten" .
Mitähän tuo käytännössä tarkottaisi
Pinta-ala ainakin lupaa lisää rikkautta ;D
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.07.2012, 00:09:47
Mitähän tuo käytännössä tarkottaisi, Suomeen tyyliin joku 50k pakolaista vuodessa?

EU:n tilaamissa laskelmissa on heitelty Suomen osalta sellaisia lukuja kuin 10-20k vuodessa (viime vuonna 3k). Lisäksi Suomi pääsisi osoittamaan solidaarisuutta ja taakanjakoa EU:n pakolaisrahastossa, joka pitäisi tämän koko EU:n kattavan sirkuksen käynnissä.

2010-03-03 Europarlamentti: Yhteinen turvapaikkapolitiikka ja taakanjako (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tykkimies Pönni - 15.07.2012, 00:32:37
Mitähän tuo käytännössä tarkottaisi, Suomeen tyyliin joku 50k pakolaista vuodessa?

EU:n tilaamissa laskelmissa on heitelty Suomen osalta sellaisia lukuja kuin 10-20k vuodessa (viime vuonna 3k). Lisäksi Suomi pääsisi osoittamaan solidaarisuutta ja taakanjakoa EU:n pakolaisrahastossa, joka pitäisi tämän koko EU:n kattavan sirkuksen käynnissä.

2010-03-03 Europarlamentti: Yhteinen turvapaikkapolitiikka ja taakanjako (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770)

Sanonpahan vaan että puuvillapeltojen orjilla oli lokoisat oltavat verrattuna siihen mitä meidän pään menoksi on suunniteltu.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jouko - 15.07.2012, 05:25:39
Mitähän tuo käytännössä tarkottaisi, Suomeen tyyliin joku 50k pakolaista vuodessa?

EU:n tilaamissa laskelmissa on heitelty Suomen osalta sellaisia lukuja kuin 10-20k vuodessa (viime vuonna 3k). Lisäksi Suomi pääsisi osoittamaan solidaarisuutta ja taakanjakoa EU:n pakolaisrahastossa, joka pitäisi tämän koko EU:n kattavan sirkuksen käynnissä.

2010-03-03 Europarlamentti: Yhteinen turvapaikkapolitiikka ja taakanjako (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770)

Sanonpahan vaan että puuvillapeltojen orjilla oli lokoisat oltavat verrattuna siihen mitä meidän pään menoksi on suunniteltu.
Nähtävästi jossain Brysselin kabineteissa päätetään pienessä piirissä mikä se taakaan koko on ja miten se jaetaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: P - 15.07.2012, 05:33:35
Euroopan unionin virallinen lehti (http://eur-lex.europa.eu/LexUriServ/LexUriServ.do?uri=OJ:C:2012:191:0134:0141:FI:PDF) 29.6.2012

Lainaus
Euroopan talous- ja sosiaalikomitean lausunto aiheesta ”Komission tiedonanto Euroopan
parlamentille, neuvostolle, Euroopan talous- ja sosiaalikomitealle ja alueiden komitealle –
Maahanmuuttoa ja liikkuvuutta koskeva kokonaisvaltainen lähestymistapa”


...

1.11
Jotta vältetään maastamuuton kielteiset vaikutukset läh­tömaiden talous- ja yhteiskuntakehitykseen, Euroopan unionin on kiinnitettävä huomiota varsinkin aivovuodon kielteisiin vai­kutuksiin ja luotava tasapainottamismekanismeja....

Saavat toivoa mitä toivovat. Euro korisee, ihmisillä etelässä todella tulee käsi suuhun. Mikä tälläisen paerille palatsissa kirjoitetun sonnahtavan tuotteen kohtalo on, kun sitä verrataan todellisuuteen? Joo. Ei etene.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.07.2012, 22:22:01
Working to complete the Common European Asylum System
UNHCR’s recommendations to Cyprus for its EU Presidency June – December 2012 (http://www.unhcr.org/4efc6aba9.html)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 01.08.2012, 13:04:08
Lainaus
Euroopan turvapaikka-asioiden tukiviraston (EASO) vuosiraportti julkaistu

Euroopan turvapaikka-asioiden tukivirasto EASO on julkaissut ensimmäisen vuosiraporttinsa. Raportissa kerrotaan turvapaikkatilanteesta EU:n alueella vuonna 2011.

Lue lisää englanniksi EASO:n lehdistötiedotteesta (http://ec.europa.eu/dgs/home-affairs/pdf/press_release_easo_annual_report.pdf).

Raportti: 2011 Annual Report on the Situation of Asylum in the European Union and on the Activities of the European Asylum Support Office. (http://ec.europa.eu/dgs/home-affairs/pdf/easo_annual_report_final.pdf)
Maahanmuuttovirasto (http://www.migri.fi/medialle/tiedotteet/lehdistotiedotteet/lehdistotiedotteet/1/0/euroopan_turvapaikka-asioiden_tukiviraston_easo_vuosiraportti_julkaistu) 30.7.2012

Lainaus
Contents

Preliminary remarks by the Chair of the Managing Board
Foreword by the Executive Director
Executive summary
Introduction


International developments, effects on Member States and EASO tools and responses
  EASO and Countries of Origin Information
  The Afghan inflow (Austria, Belgium, Germany, Netherlands, Sweden)
     Comparison of trends in asylum decisions
  The eastern Mediterranean area
  Greece
    EASO and Greece
    State of play

  EASO Asylum Intervention Pool for Emergency Support
  The ‘Arab Spring’: Tunisia, Egypt, Libya, Syria, Yemen
  EASO external dimension and third-country support
  New landings in Lampedusa, Sicily and in Malta
  Influx of asylum seekers from the Balkans
  (to Belgium, Germany, Luxembourg, Sweden and other EU countries)
  EASO and early warning
    As an example of two typical particular pressure situations:
  EASO’s approach to statistics
    Analysis of the inflow of a selection of significant countries of origin/trends
    Regional outlook


The Common European Asylum System
  The Common European Asylum System (CEAS)
  The EU asylum acquis and its implementation: new qualification directive
  and developments in national legislation and case-law
    The Dublin system
    Temporary protection
    Reception conditions
    Qualification
    Procedures
    Not directly related to asylum: detention and return
    Other instruments related to asylum

  European Refugee Fund
    The Communication on intra-EU solidarity
    ERF Community actions and EASO
    ERF: relocation
    EASO and relocation
    ERF other relevant projects with an impact on EASO

  EASO and quality activities
    EASO and unaccompanied minors
    EASO and anti-trafficking
    EASO and training

EASO’s network of institutional partners and other stakeholders
  EASO and the European Commission
  EASO and the UNHCR
  EASO and cooperation with partners and stakeholders
  EASO and civil society

Appendix
  Access to documents
Financial report
  Financial Resources
    Human Resources
List of abbreviations and acronyms
Annexes

  Statistical Tables
Endnotes

Lainaus
Foreword by the Executive Director

Support is our mission. Since its inception, EASO has been distinguishing itself as an
independent centre of expertise, support and solidarity that contributes to the development
and implementation of the Common European Asylum System (CEAS). Besides the
legal framework, the CEAS consists of another two important pillars: effective practical
cooperation, and increased solidarity and sense of responsibility among Member States.
The creation of EASO, which has been established to play a key role in supporting these two
pillars, has undoubtedly been one of the key achievements in this field during 2011.

As to the creation of the CEAS, both at the legislative and practical level significant
developments have taken place during 2011. One of the legal instruments comprising the
EU asylum acquis — the qualification directive — has been adopted, and the remaining
recast proposals — Dublin regulation, reception conditions directive and asylum procedures
directive should be adopted by December 2012 as established, among others, in the
European Pact on Immigration and Asylum (2008) and the Action Plan of the Stockholm
Programme (2010).

Lainaus
EASO plays a key role in the implementation of the Common European Asylum System
(CEAS).
It is established with the aim of enhancing practical cooperation on asylum
matters and helping Member States fulfil their European and international obligations to
give protection to people who need it.

Lainaus
The CEAS continued its development with the adoption, in December 2011, of the first
instrument of its second phase: the new Qualification Directive (Directive 2011/95/EU,
of 13 December 2011). The present report comments on a number of significant rulings
by the Court of Justice of the European Union, by the European Court of Human Rights
and by national Courts showing the growing importance of jurisprudence in clarifying the
interpretation of the EU asylum acquis.

Lainaus
As a whole, in 2011 the total number of detected irregular border crossings to the EU as reported
by Frontex increased by 35.5 % (140 980 persons) compared to 2010 (104 051 persons).

Lainaus
The eastern Mediterranean area

One of the main migration routes from Asia and Africa toward the EU goes through Turkey
and eventually through the Greek–Turkish border. It had been noted in 2010 that numbers
on the eastern Mediterranean route had been growing while the pressure in the western
Mediterranean declined. The Fundamental Rights Agency states in its Thematic Situation
Report (11) regarding irregular migration in Greece (March 2011): ‘The strengthening of
border surveillance and other measures taken by other EU southern Member States led
to a significant reduction of arrivals in Italy, Malta and Spain. Migration routes to the EU
changed, targeting first the sea border and then the land border between Greece and
Turkey. In 2010, Greek external EU land and see borders accounted for 90 % of all detections
of irregular border crossings along all EU external land and sea borders.’
The pressure at the
Greek–Turkish border continued throughout 2011 as evidenced by Frontex reports (12).
Hence a growing number of people from countries whose nationals used to go the western
Mediterranean route can now be found among the persons entering Greece irregularly
through the Greek–Turkish border, e.g. citizens from Algeria and Morocco and still many
citizens from Pakistan, Afghanistan, Georgia and the Balkans as well as citizens from sub-
Saharan countries (13).

Lainaus
The Joint EU Resettlement Programme

In the course of 2011 the negotiations on the Programme were stalled due to lack
of agreement between the co-legislators regarding the procedure to be used in the
definition of annual EU resettlement priorities. In December 2011 the Polish Presidency
of the Council agreed to take on board a compromise text that was to be further
developed by the Danish Presidency in the first semester of 2012.

EASO and Resettlement

Resettlement is as one of the key measures for internal and external solidarity.
Following its mandate EASO took part in the regular exchange of information, best
practices and other actions on resettlement by EU Member State, UNHCR, IOM, GDISC
and other relevant partners during 2011.

Lainaus
Influx of asylum seekers from the Balkans (to Belgium,
Germany, Luxembourg, Sweden and other EU countries)


Italy received around 28 000 persons of various nationalities from Libya alone after more
than 24 000 Tunisians had reached its coasts in the first semester of 2011.

Lainaus
Citizens of Serbia (including Kosovo (33)) submitted 16 791 asylum claims in the EU in 2009
— thus ranking in fifth position — 4 157 more than in 2008 (12 633 claims), an increase of
33 %. Albanian applicants were 1 966 in the same year, an increase of 57 % bringing it to the
25th position (34).

In 2010 Serbia (including Kosovo) rose to the first rank among countries of origin in the EU
with 26 726 (+ 57 %). The levels were highest in Sweden (7 900 claims), Germany (6 500),
France (5 800) and Belgium (3 100). In some cases, figures more than quadrupled (Sweden)
or trebled (Germany). Among the main receiving countries, the proportion of people from
Serbia originating from Kosovo was highest in France (84 %), Austria (66 %) and Belgium
(48 %). It was relatively low in Luxembourg (13 %), Germany (23 %) and Sweden (31 %) (35).
In addition to the influx from Serbia (including Kosovo), applications from the Former
Yugoslav Republic of Macedonia increased in significant proportion from 749 in 2009 to
5 773 in 2010 (+ 671 %) — concentrating in Germany (2 466), Belgium (1 082), Sweden
(908), France (590) and the Netherlands (389) — while applications lodged by Albanians
decreased by 8 % to 1 803 (36).

[...]

The increase in the number of applications in 2010 and 2011 was largely attributed to
the entry into force on 19 December 2009 of the decision of 30 November 2009 granting
visa-free entry to the citizens of Serbia
, FYROM and Montenegro and to the decision of
8 November 2010 for Albania and Bosnia and Herzegovina that entered into force on 16
December 2010. Indeed, the visa-free circulation creates opportunities for citizens of these
countries that have been severely hit by the economic crisis.

[...]

The EU entered into talks with the governments of the said countries and introduced a
monitoring mechanism to prevent a misuse of the asylum systems of EU Member States by
applicants making unfounded claims for asylum. Commissioner Cecilia Malmström pointed
out that a visa-free regime ‘comes with responsibilities for both the governments and the
people of the countries benefiting from this freedom.’ Albania and Bosnia were encouraged
to intensify information campaigns for their citizens on the meaning and proper use of
short-term visa-free travel.

Governments of these countries agreed to a ‘roadmap’ with the EU Commission; the
Commission monitors progress and reports to the Council.

Steps have been taken by several countries in the region to prevent their citizens from
travelling to EU Member States for other purposes than those allowed for a visit of less than
3 months: they may be asked to evidence the reason for their travel and to show that they
have sufficient financial means to support themselves during their stay and for their return.
Where the answers are unsatisfactory, the departure may be denied.

In the FYROM, the government decided that abuse of the visa-free regime may be penalised
and that people who have been forcibly returned as failed asylum seekers could have their
passports stamped or even temporarily confiscated.

The unprecedented intake of applicants from the western Balkans region severely affected
the reception and processing capacities in Belgium and Luxembourg. Their ministers in
charge of migration and asylum issues addressed on 21 October 2011 a common letter to
Commissioner Cecilia Malmström, drawing her attention to the already alarming level of the
inflow of applicants from the western Balkans. They described the saturation effect caused
by this in both the reception conditions and the asylum procedures by the high number
of claims, most of them clearly unfounded, and called on the EU Commission to take all
appropriate measures to remedy the situation
.

[...]

France declared Serbia a safe country of origin in December 2009. There was no immediate
change of orientation of the flux towards neighbouring countries. The effect of visa
liberalisation for Serbia from December 2009 was felt first in Belgium, then in Sweden
and Germany and, more recently, in Luxembourg. Regarding Albania, for which the visa
requirement was lifted in December 2010, the effect was delayed by a few months and hit
Belgium and Sweden in October 2011 after a trickle of asylum seekers had reached Germany
earlier in the year.

Although not a systematic seasonal pattern, quite a number of peaks occur in the fourth
quarter of each year
. The push and pull factors in the countries of origin and in the receiving
Member States would need a special study that would exceed the limitations of the
present report. However, it may be noted that, among several factors, the duration of the
procedures, the presence of an already established community from the same country of
origin, access to medical care and the amounts granted for voluntary return may have an
influence on the choice of a destination in the EU
.

Lainaus
The Common European Asylum System (CEAS)

Asylum is granted to people fleeing persecution or serious harm in their own country and
therefore in need of international protection. Asylum is a fundamental right; granting it is an
international obligation, first recognised in the Geneva Convention relating to the Status of
Refugees (1951).

In the EU, where there are no internal borders and countries share the same fundamental
values, there is a need to work together to find common solutions that guarantee high
standards of protection for refugees. Procedures must at the same time be fair and effective
throughout the EU and not open to abuse. With this in mind, the EU has committed to
establishing a Common European Asylum System
.

CEAS is based on three main pillars:
–– development of a legal framework, aiming at harmonising Member States’ asylum
legislation,
–– effective practical cooperation, coordinated and promoted by EASO,
–– increased solidarity and sense of responsibility among Member States and between the
EU and non-EU countries.


EASO plays a prominent role in the second and third pillar: EASO coordinates and promotes
practical cooperation and EASO is an instrument of solidarity, responsibility and trust
.

Lainaus
Temporary protection

Temporary protection is defined in Directive 2001/55/EC of 20 July 2001 on minimum
standards for giving temporary protection in the event of a mass influx of displaced persons
and on measures promoting a balance of efforts between Member States in receiving such
persons and bearing the consequences thereof (44). Temporary protection is an exceptional
measure to provide immediate and provisional protection to displaced persons from non-EU
countries who are unable to return to their country of origin. It applies in particular when
there is a risk that the standard asylum system is struggling to cope with demand stemming
from a mass influx that risks having a negative impact on the processing of claims. The
directive defines the decision-making procedure needed to trigger, extend or end temporary
protection. Solidarity and a balance of efforts between EU Member States in receiving
displaced persons are promoted through a structured mechanism. This allows for transfers
of beneficiaries between EU states, based on a voluntary offer from a state and on the
consent of the transferee. The most affected Member States would be able to rely on EASO
emergency support in case of mass influx.

In view of the influx of immigrants from Libya during the civil war, the Government of Malta
requested the triggering of the temporary protection directive.
The conditions foreseen in
the directive were not met, thus the Commission did not propose using this mechanism.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.08.2012, 20:16:20
Rebecca Cunevski tarkastelee Göteborgin yliopiston lopputyössään ruotsalaisten puolueiden kantoja EU:n yhteiseen turvapaikkajärjestelmään (CEAS) ja puolueiden motiiveja.

Cunevski, Rebecca: In search of a more restrictive asylum policy? Understanding the Swedish standpoint towards the Common European Asylum System (https://gupea.ub.gu.se/bitstream/2077/29669/1/gupea_2077_29669_1.pdf) (pdf)

Lainaus
The aim of this thesis is to investigate the motives of the Swedish political parties for pursuing supranational asylum policies in the European Union. Although Sweden generally disapproves of supranationality Sweden is one of the foremost advocators of the Common European Asylum System. This thesis seeks to investigate the motives of the Swedish political parties for pursuing this agenda by testing the applicability of three theories on migration policy harmonization in Europe; burden-sharing, venue-shopping and international solidarity, which have rarely been empirically applied. As the empirical knowledge of the political parties’ preferences towards the common asylum system is limited the preferences will be mapped out. The empirical analysis has been conducted using motive analysis and covers three policy cases from 1998-2009; the Schengen Convention, “The directive on mutual recognition of expulsion decisions” and the Stockholm Programme. The empirical analysis shows that the Social Democratic Party and the Moderate Party agree that asylum policy should be supranational and restrictive. The smaller parties prefer generous asylum policies but are divided on the supranational line were the Left Party and Green Party prefer intergovernmentalism. The motives of the Social Democratic Party and the Moderate Party can be explained by burden-sharing and venue-shopping. International solidarity is a motive for all the small parties while burden-sharing also plays a role for some of the centre-right parties.
Tiivistelmä (http://www.essays.se/essay/204fb3c200/)

Lainaus
One of the strongest supporters of the CEAS is Sweden, which is quite mysterious
considering the fact that Sweden is quite hesitant about supranationality in most other policy
areas (Andersson, 2008; Vink, 2002; Abiri, 2000). Swedish asylum policy has traditionally
been associated with solidarity and generosity, and considering the connection made between
the EU’s migration policy and the construction of ‘Fortress Europe’ the supportive Swedish
position seems even more odd (Hansen, 2008; Givens, 2003). How can this be explained?

Lainaus
The aim of this thesis is twofold. Firstly the aim is to map out the preferences of the political
parties in terms of (1) supranational or intergovernmental, and (2) generous or restrictive
preferences in order to increase our knowledge of how the parties position themselves in
European asylum policy-making. Do patterns emerge over time and can parallels be drawn to
the national asylum policy debate? Furthermore, the aim is to explain the motives of the
political parties using theories on burden-sharing, venue-shopping and international solidarity
to see which, if any, of these perspectives impacts the parties.

Lainaus
Three commonly applied theories in research on migration policy harmonization in Europe
are (1) venue-shopping, (2) securitization and (3) burden-sharing.
These theoretical
perspectives offer different explanations as to why the member states would want to
harmonize migration policy. While securitization highlights that the motor of harmonization
is the description of asylum seekers as security threats (Huysmans, 2000; Guild, 2003) venue-
shopping points to the fact that policy pressure and political opposition motivate the dominant
actors to harmonize (Guiraudon, 2000, 2003; Givens & Luedkte, 2004). Burden-sharing on
the other hand explains asylum policy harmonization in the light of leveling out the reception
of refugees between the member states in the EU (Thielemann, 2008).

Tämä muistuttaa suomalaisesta maahanmuuttopoliittisesta keskustelusta:
Lainaus
2.2.1 Venue-shopping
Venue-shopping is one of the theories used in this thesis to explain the motives of the political
parties in seeking out supranational asylum policies. One of the first researchers to apply
venue-shopping to the development of EU migration policy was Virginie Guiraudon (2000,
2003). Venue-shopping focuses on the national level and emphasizes the role of domestic
political pressure. The dominant political actors may face resistance in carrying out their
political agenda due to institutional constraints or political opposition. By transferring asylum
policy to a new political venue, i.e. the EU, the national political or institutional opposition
may be bypassed.
Venue-shopping is thereby a way for political actors to regain control.
Using the EU the dominant party may cement their asylum policy preferences as it is very
hard to undo EU legislation. Parties who ‘venue-shop’ may also use EU as a scapegoat for the
new asylum policy. It is not only political actors that can gain from venue-shopping but also
public officials who often face less institutional constraints at the supranational level.
The
consequence of venue-shopping is that EU migration policy only reflects the preferences of
the dominant actors in each member state (Guiraudon, 2000: 257-58).

Suomessa sekä maahanmuuttopoliittisia käytäntöjä (EU-romanien turvapaikkakäsittely, perheenyhdistämiskäytännöt jne.) että uudistuksia (vuoden 2009 uusi ulkomaalaislaki) perustellaan tarvittaessa EU:n vaatimuksilla tai "kansainvälisillä sopimuksilla", oli sellaisia sitten oikeasti olemassa tai ei. Päätösvalta etenkin turvapaikka-asioissa halutaan siirtää EU-tasolle (Suomi Ruotsin kanssa innokkaimpia CEAS:in edistäjiä), mahdollisesti siksi, että maahanmuuttopolitiikkaa ei voisi enää käyttää sisäpolitiikassa poliittisena teemana. Tämä sopisi vanhoille puolueille paremmin kuin hyvin, ja sisäministeri Räsäsen ohjauksessa Suomen CEAS-projekti etenee edelleen hitaasti mutta varmasti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 08.09.2012, 10:44:26
Päätöslauselmaesitys (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-//EP//TEXT+REPORT+A7-2012-0248+0+DOC+XML+V0//FI) esitellään Euroopan parlamentille 10.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120910&secondRef=SIT&language=FI#D-57) ja sen hyväksymisestä äänestetään 11.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120911&secondRef=SIT&language=FI#V-57)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 08.09.2012, 12:14:32
Päätöslauselmaesitys (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-//EP//TEXT+REPORT+A7-2012-0248+0+DOC+XML+V0//FI) esitellään Euroopan parlamentille 10.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120910&secondRef=SIT&language=FI#D-57) ja sen hyväksymisestä äänestetään 11.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120911&secondRef=SIT&language=FI#V-57)

Jälleen yksi rahansiirtokone:
Lainaus
Yhteisvastuuseen perustuva rahoitus

20. rohkaisee jäsenvaltioita hyödyntämään täysimääräisesti Euroopan pakolaisrahaston tarjoamia mahdollisuuksia kohdennettujen toimien toteuttamiseen turvapaikkajärjestelmien parantamiseksi; suosittaa, että jäsenvaltiot toteuttavat toimia hallintomenettelyjen monimutkaisuuden, varojen hyödyntämisen viivästymisen ja likviditeettiongelmien kaltaisiin asioihin puuttumiseksi, jotta voidaan varmistaa varojen tehokas ja nopean jakaminen;

21. muistuttaa, että jäsenvaltioiden on toimittava siten, että ne voivat käyttää täysipainoisesti Euroopan pakolaisrahaston tarjoamia mahdollisuuksia ja olla varmoja siitä, että kaikki myönnetyt varat voidaan maksaa, jotta hankevastaavat eivät joudu vaikeuksiin rahoitettuja hankkeita toteutettaessa;

Kreikan rajat vuotavat ja siellä on pakolaisilla epäinhimilliset olot. Kreikka ei tee mitään rajojen sulkemiseksi, mutta kuittaa EU:n rahastolta muutaman miljardin, jotta voi vaihtaa apeat verhot kukikkaisiin. Troikka käy tarkastamassa eikä löydä mitään verhoja, mutta kuulemma pakolainen on myynyt ne torilla ja vaihtanut ruokaan. Ei voi mitään. Ja suomipoika maksaa.

Nyt heti irti eurosta, eu:sta ja schengenistä. Muutaman miljardin budjettivaje pakolaisrahaston perustamiseksi ja 30 000 pakolaisen vastuidenjakoryöppy parina vuonna peräkkäin, ja Suomi ei ole enää koskaan entisensä: Turvallinen paikka jonne syntymistä vieläkin rinnastan lottovoittoon. Kataisesta huolimatta.

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.09.2012, 12:53:31
Päätöslauselmaesitys (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-//EP//TEXT+REPORT+A7-2012-0248+0+DOC+XML+V0//FI) esitellään Euroopan parlamentille 10.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120910&secondRef=SIT&language=FI#D-57) ja sen hyväksymisestä äänestetään 11.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120911&secondRef=SIT&language=FI#V-57)

Tämä on nyt sitä itseään.

Lainaus
5.  ottaa huomioon, että turvapaikan hakijoiden määrä on kasvanut vuonna 2011, mutta korostaa, että yleisesti turvapaikkahakemusten määrä on vähentynyt EU:ssa viime vuosikymmenen aikana merkittävästi; korostaa, että tietyt jäsenvaltiot vastaanottavat suhteettoman suuren määrän turvapaikkahakemuksia muihin verrattuna, mikä johtuu maantieteellisistä ja monista muista syistä, ja toteaa, että turvapaikkahakemukset jakautuvat epätasaisesti unionissa; muistuttaa, että vuonna 2011 yli 90 prosenttia turvapaikkahakemuksista jätettiin kymmenessä jäsenvaltiossa, ja toteaa, että kesään 2011 mennessä Maltasta uudelleensijoitettiin EU:hun vain 227 kansainvälistä suojelua saavaa henkilöä kuuteen muuhun jäsenvaltioon ja vuonna 2011 koko EU:ssa vain 4 125 pakolaista uudelleensijoitettiin vain kymmeneen EU:n jäsenvaltioon, mikä on noin 6,6 prosenttia kaikista kyseisen vuoden aikana uudelleensijoitetuista; painottaa, että näitä eroja on välttämättä täsmennettävä esimerkiksi vertailemalla absoluuttisia lukuja ja valmiusindikaattoreita ja että EU:n on lisättävä sekä hallinnollista että taloudellista tukeaan niille jäsenvaltioille, jotka vastaanottavat eniten turvapaikkahakemuksia;

6.  painottaa, että turvapaikanhakijoiden ja kansainvälistä suojelua saavien henkilöiden suojelun korkeaa tasoa ei voida saavuttaa eikä perusteltuja turvapaikkapäätöksiä voida tehdä, jos jäsenvaltioiden välisiä eroja turvapaikkahakemusten osuuksissa suhteessa yksittäisen jäsenvaltion hallinnolliseen ja tekniseen vastaanottokykyyn ei tasoiteta;

Lainaus
25. korostaa taloudellisen vastuunjaon tärkeyttä turvapaikka-asioissa ja suosittaa, että luotaisiin hyvin rahoitettu mekanismi, jotta voitaisiin ottaa vastaan turvapaikanhakijoita ja kansainvälistä suojelua saavia henkilöitä absoluuttisesti tai suhteellisesti suurempi määrä ja avustaa jäsenvaltioita, joiden turvapaikkajärjestelmät ovat puutteelliset; katsoo, että lisätutkimukset ovat tarpeen turvapaikkahakemusten vastaanottamisesta ja käsittelystä aiheutuvien todellisten kulujen selvittämiseksi; kehottaa tämän vuoksi komissiota toteuttamaan tutkimuksen niiden varojen arvioimiseksi, jotka olisi osoitettava kunkin jäsenvaltion vastuun perusteella, seuraavan kaltaisten indikaattorien perusteella: ensimmäisten turvapaikkahakemusten määrä, pakolaisaseman tai tilapäisen suojelun myöntämispäätösten määrä, uudelleensijoitettujen pakolaisten määrä, palauttamispäätösten ja -operaatioiden määrä ja pysäytettyjen laittomien maahantulijoiden määrä;

Miksi ihmeessä asetetaan tavoitteeksi ottaa vastaan turvapaikanhakijoita ja kiintiöpakolaisia absoluuttisesti tai suhteellisesti suurempi määrä?

Lainaus
Vastuunjako

32. suhtautuu myönteisesti siihen, että komissio on sitoutunut tekemään kattavan arvioinnin Dublin-järjestelmästä vuonna 2014 ja käymään läpi järjestelmän oikeudelliset, taloudelliset ja sosiaaliset sekä ihmisoikeuksiin kohdistuvat vaikutukset, kuten vaikutukset naisturvapaikanhakijoiden tilanteeseen; katsoo, että on edelleen tarkasteltava tasapuolisen vastuunjakomekanismin kehittämistä sen määrittämiseksi, minkä jäsenvaltion olisi vastattava turvapaikkahakemusten käsittelystä, koska näin voitaisiin antaa nopeasti ja tehokkaasti käytännön tukea jäsenvaltiolle hätätilanteissa ja paineiden kasvaessa suhteettomiksi;

33. katsoo, että Dublin-asetuksella, jossa säädetään turvapaikkahakemuksia koskevan vastuun jakamisesta, sälytetään kohtuuton taakka jäsenvaltioille, jotka ovat EU:hun suuntautuvan muuton maahantulopaikkoja, eikä järjestelmässä käsitellä turvapaikkavastuun tasapuolista jakautumista jäsenvaltioiden kesken; toteaa, että Dublin-järjestelmän soveltaminen on tähän mennessä johtanut turvapaikanhakijoiden eriarvoiseen kohteluun joissakin jäsenvaltioissa ja aiheuttanut haittaa perheenyhdistämiselle ja kotoutumiselle, sillä turvapaikkajärjestelmien erot ovat hyvin suuret ja turvapaikkasäännöstön täytäntöönpano on ollut riittämätöntä; korostaa myös Dublin-asetuksen tehokkuuteen ja kustannustehokkuuteen liittyviä puutteita, koska yli puolet hyväksytyistä siirroista jää tekemättä ja saman henkilön useita turvapaikkahakemuksia jätetään edelleen merkittäviä määriä; kehottaa komissiota ja jäsenvaltioita varmistamaan, että jäsenvaltioon Dublin II -asetuksen perusteella palautetut turvapaikanhakijat eivät saa huonompaa kohtelua vain koska he ovat Dublin II -asetuksen mukaisesti palautettuja;

Suomeksi: Dublin-sopimus halutaan romuttaa, jotta turvapaikanhakijat pääsisivät helpommin pohjoiseen.

Lainaus
Turvapaikkahakemusten yhteiskäsittely

35. katsoo, että on välttämätöntä jatkaa vuoropuhelua turvapaikanhakijoita ja kansainvälistä suojelua saavia henkilöitä koskevan vastuun jakamisesta sekä vuoropuhelua suojelunormien parantamista edistävien välineiden, kuten turvapaikkahakemusten yhteiskäsittelyn (jäljempänä "yhteiskäsittely") ja uudelleensijoittamista koskevien ohjelmien, käyttämisestä;

36. katsoo, että yhteiskäsittely voisi olla hyödyllinen solidaarisuuden ja vastuun jakamisen väline erilaisissa tapauksissa, erityisesti kun jäsenvaltio kohtaa merkittäviä tai äkillisiä turvapaikanhakijoiden virtoja tai kun turvapaikkahakemukset ruuhkautuvat merkittävästi, mikä viivästyttää ja murentaa turvapaikkamenettelyä turvapaikanhakijoiden haittaavalla tavalla; katsoo, että yhteiskäsittelyllä voitaisiin ehkäistä tai ratkaista kapasiteettiongelmia, vähentää turvapaikkaprosesseihin liittyviä rasitteita ja kustannuksia, nopeuttaa turvapaikkahakemusten käsittelyä sekä jakaa vastuu hakemusten käsittelystä entistä tasapuolisemmin; painottaa, että yhteiskäsittely edellyttää selkeää vastuunjakoa siihen osallistuvien jäsenvaltioiden kesken, jotta vältetään vastuun siirto, ja korostaa lisäksi, että päätöksenteko on edelleen jäsenvaltioiden vastuulla; toteaa, että tätä olisi täydennettävä järjestelmällä, jolla varmistetaan vastuun tasapuolisempi jakautuminen sen jälkeen kun hakemukset on käsitelty;

Hakemusten käsittely ja sitä kautta päätösvalta pois jäsenmailta.

Lainaus
Kansainvälistä suojelua saavien henkilöiden ja turvapaikanhakijoiden uudelleensijoittaminen

47. kehottaa komissiota ottamaan ehdotuksessaan EU:n pysyvästä tehokkaasta uudelleensijoittamismekanismista huomioon EU:n jakoperusteen, jossa tarkastellaan kansainvälisen suojelun saajien uudelleensijoittamista sellaisten asianmukaisten indikaattorien avulla, jotka kuvaavat jäsenvaltion vastaanotto- ja kotouttamisvalmiuksia, kuten jäsenvaltion BKT, väkiluku ja pinta-ala, ja joissa otetaan huomioon suojelun saajien edut ja kotoutumismahdollisuudet; katsoo, että tällaista EU:n jakoperustetta voitaisiin soveltaa jäsenvaltioihin, joiden turvapaikkajärjestelmiin kohdistuu erityisiä ja suhteettomia paineita, tai vastaavasti hätätilanteissa; painottaa, että uudelleensijoittaminen riippuu aina kansainvälisen suojelun saajien suostumuksesta ja että eurooppalaisen jakoperusteen käyttöönotolla ei rajoitettaisi jokaisen jäsenvaltion velvoitetta panna täytäntöön ja soveltaa EU:n nykyistä turvapaikkalainsäädäntöä suojelutarpeen, vastaanotto-olosuhteiden ja menettelyllisten takeiden osalta ja noudattaa kaikkia alan kansainvälisiä velvoitteita;

50. on tyytyväinen rahoitusmahdollisuuksiin, jotka turvapaikka- ja maahanmuuttorahasto tarjoaa turvapaikanhakijoiden uudelleensijoittamista varten, ja kannustaa jäsenvaltioita osallistumaan vapaaehtoisiin aloitteisiin ottaen huomioon turvapaikanhakijoiden kaikki oikeudet ja sen, että heidän suostumuksensa tarvitaan; kehottaa komissiota tutkimaan turvapaikanhakijoiden uudelleensijoittamista koskevan EU:n järjestelmän kehittämisen toteuttamiskelpoisuutta ja tarkastelemaan muun muassa mahdollisuuksia käyttää järjestelmän perustana EU:n jakoperustetta, jossa otetaan asianmukaisesti huomioon sellaiset todennettava kriteerit kuin jäsenvaltion BKT, väkiluku ja pinta-ala sekä turvapaikanhakijoiden edut ja kotoutumismahdollisuudet; katsoo, että tällaista ohjelmaa voitaisiin käyttää solidaarisuuden välineenä silloin, kun turvapaikanhakijoiden määrä on suhteettoman suuri suhteessa jäsenvaltion turvapaikkajärjestelmän kapasiteettiin, tai hätätapauksissa;

Turvapaikanhakijat jaetaan EU-maiden kesken jäsenvaltion BKT:hen, väkilukuun, pinta-alaan sekä vastaanotto- ja kotouttamisvalmiuksiin perustuen. Suomi olisi EU:n selvitysten mukaan näillä perusteilla Ruotsin ohella Euroopan kärjessä vastaanottajamaana. Ruotsi on jo Euroopan ykkönen turvapaikanhakumaana, joten siellä ei mikään muuttuisi, mutta Suomi muutettaisiin toiseksi Ruotsiksi.

Lainaus
52. panee merkille, että komissio on ilmoittanut harkitsevansa aina tilapäistä suojelua koskevan direktiivin mekanismin käyttöönottoa, jos sitä koskevat ehdot täyttyvät, erityisesti kun kyseessä on jo alkanut tai välittömästi uhkaava joukottainen maahantulo, jossa siirtymään joutuneet henkilöt eivät voi palata lähtömaahansa turvallisesti ja pysyvästi; kehottaa komissiota tekemään mahdolliseksi tämän direktiivin aktivoimisen myös tapauksissa, joissa joukottainen maahantulo koskee vähintään yhtä jäsenvaltiota, eikä pelkästään silloin, kun kyseessä on joukottainen maahantulo koko EU:n kannalta;

Tilapäistä suojelua koskevan direktiivin (tulijoille parin vuoden määräaikainen oleskelulupa EU-alueella ilman turvapaikkatutkintaa) käyttöönoton kynnystä halutaan madaltaa. Taustalla lienee Italiaan arabikevään aikana pyrkineet 25 000 tunisialaista onnenonkijaa, joita varten siis jatkossa otettaisiin käyttöön tilapäisen suojelun direktiivi vain siksi, että heitä on paljon, vaikka kyseessä eivät edes ole oikeat turvapaikanhakijat.

Tämä on vasta periaatepäätös eikä käytännön toteutus, mutta esitys ei saisi missään tapauksessa mennä läpi. Mikä on Suomen kanta turvapaikkapoliittisesta päätösvallasta luopumiseen ja koko Euroopan vastaanottokeskukseksi ryhtymiseen?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 08.09.2012, 12:59:47
Hyväksymisestä äänestetään 11.9. (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20120911&secondRef=SIT&language=FI#V-57)

Suoraa vittuilua valita hyväksymispäiväksi juuri 9/11 :'(  >:(
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jouko - 08.09.2012, 13:15:39
Mainittakoon vielä kertaalleen että kansainvaellukseenhan se muinainen Rooman imperiukin kaatui. Historia pukkaa toistamaan itseään. Ei sillä että sen nykyisen imperiumin kaatuminen olisi niin huono juttu vaan kun me olemme siinä mukana toistaiseksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RTT - 08.09.2012, 14:06:07
Kreikan rajat vuotavat ja siellä on pakolaisilla epäinhimilliset olot. Kreikka ei tee mitään rajojen sulkemiseksi, mutta kuittaa EU:n rahastolta muutaman miljardin, jotta voi vaihtaa apeat verhot kukikkaisiin.
Offtopicia, mutta ollaanhan sinne paraikaa rakentamassa EU:n paheksunnasta huolimatta 12 kilometrin raja-aita. Elokuun alussa (http://euobserver.com/justice/117124) Turkin vastaisen rajan valvojien määrä kolminkertaistettiin kuudestasadasta melkein kahteentuhanteen. Laittomia maahanmuuttajia vastaan on aloitettu kiinniotto-operaatiot. EU:n itsensä vaatimaa Kreikan turvapaikkajärjestelmän remonttia ei voitu tänä vuonna totetuttaa, koska troikan määräykset kieltävät palkkaamasta uusia ihmisiä julkiselle sektorille.

Kyllä siellä hommia on tehty.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Histon - 08.09.2012, 15:16:26
Toivottavasti kaikki perussuomalaiset kansanedustajamme tarttuvat tähän asian vaatimalla tarmolla ja vakavuudella. Suomen näkökulmasta kyseessä on perustavanlaatuisempi asia, kuin esimerkiksi Euroopan talouskriisin hoito ja EU/euro- jäsenyys, jotka nekin sinänsä ovat mammuttiluokan kysymyksiä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 08.09.2012, 18:03:19
Kreikan rajat vuotavat ja siellä on pakolaisilla epäinhimilliset olot. Kreikka ei tee mitään rajojen sulkemiseksi, mutta kuittaa EU:n rahastolta muutaman miljardin, jotta voi vaihtaa apeat verhot kukikkaisiin.
Offtopicia, mutta ollaanhan sinne paraikaa rakentamassa EU:n paheksunnasta huolimatta 12 kilometrin raja-aita. Elokuun alussa (http://euobserver.com/justice/117124) Turkin vastaisen rajan valvojien määrä kolminkertaistettiin kuudestasadasta melkein kahteentuhanteen. Laittomia maahanmuuttajia vastaan on aloitettu kiinniotto-operaatiot. EU:n itsensä vaatimaa Kreikan turvapaikkajärjestelmän remonttia ei voitu tänä vuonna totetuttaa, koska troikan määräykset kieltävät palkkaamasta uusia ihmisiä julkiselle sektorille.

Kyllä siellä hommia on tehty.

On joo hommia tehty. Iski vaan depis, kun mietin tätä kokonaiskuvaa ja sen vaikutuksia Suomen talouteen ja hyvinvointiin.

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 11.09.2012, 17:49:00
Toivottavasti kaikki perussuomalaiset kansanedustajamme tarttuvat tähän asian vaatimalla tarmolla ja vakavuudella. Suomen näkökulmasta kyseessä on perustavanlaatuisempi asia, kuin esimerkiksi Euroopan talouskriisin hoito ja EU/euro- jäsenyys, jotka nekin sinänsä ovat mammuttiluokan kysymyksiä.

Tämä voisi jo hyvinkin olla jonkin Smash CEAS -mielensoituksen paikka.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Marko M - 11.09.2012, 18:35:17
Käsittämättömiä lukuja ,Suomi joutuisi ottamaan vastaan enemmän rikastajia  kuin Saksa tai Englanti.

http://www.statewatch.org.s3.incloak.com/news/2010/nov/eu-com-final-report-relocation-of-refugees.pdf

Suomen hallituksen diibadaabaa.

http://www.monitori-lehti.fi.s3.incloak.com/intermin/monitori/cms.nsf/www/maahanmuuttopolitiikka
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 11.09.2012, 18:50:36
Kannattaisi persujen pitää meteliä tästä asiasta, että tässä ei käy kuten rikkidirektiivissä, eli että herätään asiaan vasta esityksen tullessa voimaan. Lähetin muutamalle kokoomusedustajalle sähköpostia asiasta ja he tuntuivat olevan tietämättömiä EU:n yhteisestä turvapaikkapolitiikasta, mutta sentään lupasivat pikimmiten tutustua asiaan, sillä raportissa olleet asiat eivät heistäkän näyttäneet hyviltä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 11.09.2012, 19:03:26
Sanahelinää asiasta kuuluu varmaan mutta luulisi että kansan enemmistölle alkaisi olla selvää se että ainoa järkevä liike on erota EU:sta ja mahdollisimman nopeasti. EU jäsenyyttä ajavat kokoomus ja äärivasemmisto ovat kaunistelematta sanoen suomalaisvastaisia eikä niiden luulisi saavan enää yli puolta äänistä. Ei luulisi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: svobo - 11.09.2012, 19:42:17
Innostuin nyt lukemaan noita eeuu-uutisia, ni pistetään tämäkin tänne:

http://www.europarl.europa.eu/news/en/pressroom/content/20120907IPR50814/html/Asylum-policy-MEPs-call-for-fair-shares-and-solidarity (http://www.europarl.europa.eu/news/en/pressroom/content/20120907IPR50814/html/Asylum-policy-MEPs-call-for-fair-shares-and-solidarity)

Lainaus
""In this text we have spelled out what solidarity means in practice: burden sharing between the different Member States. Now we look to the Commission to pass on to us the relevant legislative proposals so that we can continue the work we committed to undertake since 1999", explained rapporteur Kyriacos Triantaphyllides (GUE/NGL, CY) in a debate on Monday evening. His resolution was adopted with 584 in favour, 41 against and 54 abstentions.
Otsikko: Vs: Kirj.Kysymys Maria Lohela (oli: EU:n yhteinen pakolaispolitiikka)
Kirjoitti: qwerty - 12.09.2012, 14:45:19
KIRJALLINEN KYSYMYS 671/2012 vp (http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml)

EU:n yhteinen turvapaikkapolitiikka ja taakanjako

Eduskunnan puhemiehelle

Euroopan unionissa on ollut pyrkimyksenä yhtenäistää paitsi finanssijärjestelmiä myös muita yhteiskunnan rakenteita, esimerkiksi maahanmuutto- ja turvapaikkapolitiikkaa. Tähän on viime aikoina luonut paineita yleisen harmonisoinnin - ns. liittovaltiokehityksen - lisäksi myös arabikevään aiheuttama Pohjois-Afrikan kansojen muuttoaalto Eurooppaan. Asia on kuohuttanut etenkin Etelä-Euroopan unionimaita: Euroopan reunavaltioiden Italian ja Ranskan välit kärjistyivät vuonna 2011 siinä määrin, että Ranska uhkasi irtautua Schengen-sopimuksesta. Italia puolestaan on vaatinut muilta EU-mailta apua Afrikan siirtolaistensa jakamisessa. EU:ssa onkin pohdittu ratkaisuja turvapaikka-asioista aiheutuvien rasitteiden oikeudenmukaiseen jakamiseen EU-maiden välillä.

EU:n yhteiselle turvapaikkapolitiikalle luotiin pohja jo vuonna 1999 Tampereen huippukokouksessa. Vuosina 1999-2005 luotiin puitteet yhteisen eurooppalaisen turvapaikkajärjestelmän perustamiseksi (muun muassa direktiivi turvapaikanhakijoiden vastaanotto-olosuhteista, direktiivi turvapaikkamenettelystä ja Dublin-asetus) ja vuonna 2008 saatiin toiminnan suuntaviivat Euroopan komission Turvapaikkapolitiikan toimintasuunnitelman muodossa. Suunnitelma sisältää muun muassa kolme ulottuvuutta, joilla yhteistä turvapaikkajärjestelmää tuetaan. Näihin kuuluu Lissabonin sopimuksen myötä solidaarisuuden ja reilun taakanjaon periaate, minkä toimeenpanemiseksi komissio ehdotti jäsenvaltioiden keskinäisen solidaarisuuden lisäämistä turvapaikka-asioissa. Tavoitteena on jakaa turvapaikanhakijoiden vastaanottamisesta syntyvää kuormitusta jäsenmaiden kesken joko suoraan turvapaikanhakijoita siirtämällä tai taloudellisin kompensaatioin lukumäärällisesti tai suhteellisesti muita enemmän pakolaisia vastaanottaville maille. Euroopan komissiolle tehdyssä tutkimuksessa on taakanjakoperiaatteeksi ehdotettu jäsenmaan väkilukua, BKT:tä ja väestötiheyttä tietyin painotuksin. Lisäksi kansainvälistä suojelua saavien etu ja kotoutumismahdollisuudet kohdemaassa voitaisiin ottaa huomioon. Näihin periaatteisiin perustuvissa laskelmissa jopa 40 % turvapaikkahakemuksista siirrettäisiin hakemuksen vastaanottajamaasta toisaalle eli käytännössä eteläisestä Euroopasta muihin EU-maihin. Suomen ja Ruotsin kaltaisten kehittyneiden, suhteellisen harvaanasuttujen maiden osuus taakanjaosta tulisi oletettavasti olemaan Euroopan suurimpia. Esimerkiksi Suomen kohdalla puhutaan turvapaikanhakijamäärien moninkertaistumisesta; tällaista päätöstä voidaankin pitää Suomen kannalta taloudellisesti musertavana ja maamme suvereniteettia kaventavana.

EU on sitoutunut saamaan yhteiseen turvapaikkamenettelyyn perustuvan Euroopan yhteisen turvapaikkajärjestelmän valmiiksi tämän vuoden aikana. Asiassa otettiinkin kesän 2012 aikana monta suurta askelta; asia valmisteltiin Kansalaisvapauksien sekä oikeus- ja sisäasioiden LIBE-valiokunnassa ja heinäkuussa syntyneestä päätöslauselmaesityksestä EU:n sisäisen solidaarisuuden lisäämisestä turvapaikka-asioissa (2012/2032(INI)) äänestettiin 11.9.2012 Euroopan parlamentissa. Päätöslauselmaesitys hyväksyttiin. Hallitus on antanut tukensa EU:n yhteiselle turvapaikkajärjestelmälle todeten hallitusohjelmassaan seuraavaa: "Suomi toimii aktiivisesti EU:n yhteisen turvapaikka- ja maahanmuuttopolitiikan aikaansaamiseksi." Vaalikauden aikana asiasta on silti vaiettu; turvapaikanhakijoiden siirtäminen eri maiden välillä onkin epähumaanilta kuulostavaa toimintaa ja myös poliittisesti arkaluontoinen aihe. Siitä on kuitenkin uskallettava puhua nyt, kun asiassa on edetty EU-tasolla jo näinkin pitkälle.

Edellä olevan perusteella ja eduskunnan työjärjestyksen 27 §:ään viitaten esitän asianomaisen ministerin vastattavaksi seuraavan kysymyksen:

    Kannattaako hallitus EU:n yhteistä taakanjakoa turvapaikka-asioissa,

    miten hallitus on varautunut sen tarkoittamaan turvapaikanhakijamäärien merkittävään kasvuun Suomessa ja

    onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?

Helsingissä 12 päivänä syyskuuta 2012
Maria Lohela /ps
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 12.09.2012, 15:59:51
Enhanced intra-EU solidarity in the field of asylum (http://www.votewatch.eu/en/enhanced-intra-eu-solidarity-in-the-field-of-asylum-motion-for-a-resolution-single-vote.html)

For 584 (86%) Against 41 (6%) Abstentions 54 (8%)

SuomalaisMEPit äänestivät seuraavasti:

PUOLESTA (8 ): Jaakonsaari (SDP), Jäätteenmäki, Takkula, Manner (Kesk.), Pietikäinen, Sarvamaa (Kok.), Torvads (RKP), Hassi (Virh.)
VASTAAN (1): Terho (PS)
TYHJÄ (1): Essayah (KD)
POISSA (3): Repo (SDP), Korhola (Kok.), Cronberg (Virh.)

Muita mielenkiintoisia:
Nigel Farage Poissa, Daniel Hannan Tyhjä
Nick Griffin, Jean-Marie Le Pen ja Marine Le Pen Vastaan
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Marko M - 12.09.2012, 16:24:20
Enhanced intra-EU solidarity in the field of asylum (http://www.votewatch.eu/en/enhanced-intra-eu-solidarity-in-the-field-of-asylum-motion-for-a-resolution-single-vote.html)

For 584 (86%) Against 41 (6%) Abstentions 54 (8%)

SuomalaisMEPit äänestivät seuraavasti:

PUOLESTA (8 ): Jaakonsaari (SDP), Jäätteenmäki, Takkula, Manner (Kesk.), Pietikäinen, Sarvamaa (Kok.), Torvads (RKP), Hassi (Virh.)
VASTAAN (1): Terho (PS)
TYHJÄ (1): Essayah (KD)
POISSA (3): Repo (SDP), Korhola (Kok.), Cronberg (Virh.)

Muita mielenkiintoisia:
Nigel Farage Poissa, Daniel Hannan Tyhjä
Nick Griffin, Jean-Marie Le Pen ja Marine Le Pen Vastaan

Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 12.09.2012, 16:52:25
Hienoa Lohelalta. Saa ainakin aikaan jotain eduskuntakeskustelua, jota media ei toivottavasti kokonaan tukahduta. Mahtaako olla suunniteltua, että Mestari ei aina ole äänessä, vai onkohan sitäkin tulossa?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 12.09.2012, 16:59:42

Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Ja kristillisdemokraatitkin äänesti tyhjää.  >:(
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Miniluv - 12.09.2012, 18:08:54
Päätyi etusivulle nopeammin, kun qwerty muistutti. Kymmenen pistettä ja papukaija hihamerkki :)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Adolf Stege - 12.09.2012, 18:17:42
Kyllä tämä nyt näyttää ja tuntuu entistä pahemmalta. Kansalaiset ei tiedä tästäkään asiasta yhtään mitään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Professori - 12.09.2012, 18:26:18
Kyllä tämä nyt näyttää ja tuntuu entistä pahemmalta. Kansalaiset ei tiedä tästäkään asiasta yhtään mitään.

Mutta juuri siksi pitää asia nostaa eduskunnassa esille. Vain niin voidaan asia saada marginaalista suuremman joukon tietoisuuteen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Adolf Stege - 12.09.2012, 18:32:23
Olis tietysti mukavaa, jos Suomen media nostas asian tapetille. Taitaa olla turha sitä toivoo.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: svobo - 12.09.2012, 18:54:48
Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Niin on.

Tämä on suomalaisuuden säilymisen kannalta uhkaavin tilanne sitten Talin-Ihantalan taistelun. Jos tuo maahanmuuttoautomaatti päästetään päälle ja sen kiinni kääntäminen ei enää onnistu, koska "kansainväliset sopimukset", niin Suomi on tuhon oma. Tuho lävistää koko yhteiskunnan ja se on peruuttamaton. Vikaan mennyttä maahanmuuttoa ei voi enää tehdä tekemättömäksi.

Tämän päätöksen puolesta äänestäneiden päättäjien kädet ovat tulevien sukupolvien veressä!
Otsikko: Vs: Kirj.Kysymys Maria Lohela (oli: EU:n yhteinen pakolaispolitiikka)
Kirjoitti: akez - 12.09.2012, 19:23:28

EU:n yhteinen turvapaikkapolitiikka ja taakanjako

Solidaarisuus ja taakanjako ovat hyviä ideoita, kun kyse on tälläisestä hankkeesta:

"Kreikka pystyttää 10 kilometriä pitkän muurin estääkseen laitonta maahantuloa Turkista. EU kieltäytyy antamasta Ateenalle varoja sen rakentamiseksi." linkki (http://hommaforum.org/index.php/topic,68946.msg962278.html#msg962278)

Mutta jos on kyse esim. Pohjois-Afrikan ja Lähi-Idän irtopopulan imuroimisesta tänne ja sakin jaosta eu-mahtikäskyllä jäsenmaille, niin poskelleen menee ja pahasti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Teiskolainen - 12.09.2012, 20:07:28
Hienoa Lohelalta. Saa ainakin aikaan jotain eduskuntakeskustelua, jota media ei toivottavasti kokonaan tukahduta. Mahtaako olla suunniteltua, että Mestari ei aina ole äänessä, vai onkohan sitäkin tulossa?

Oikein itsekin silmiäni hieraisin, kun huomasin Lohelan kysymyksen tekijäksi.
Kaikkea kummallista nuo lähestyvät kunnallisvaalit saavat aikaiseksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaakko P. - 12.09.2012, 22:05:30
Miksei voi vain olla tyytyväisiä ettei meillä ole ZUS:eja, kymmeniä tuhansia jihadisteja, lainsuojattomia lähiöitä ja muita holtittoman maahanmuuton sivutuotteita. Miksi pitää ehdoin tahdoin pilata koko valtio. Ja koska kansa EI toivo että valtio pilataan, tehdään tämä kansalta salaa jos suinkin mahdollista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 12.09.2012, 22:07:33
Hienoa Lohelalta. Saa ainakin aikaan jotain eduskuntakeskustelua, jota media ei toivottavasti kokonaan tukahduta. Mahtaako olla suunniteltua, että Mestari ei aina ole äänessä, vai onkohan sitäkin tulossa?

Milloin Mestari ylipäätään on viimeksi ollut äänessä? Useimmitenhan suurimman osan mamupoliittisista kysymyksistä on tehnyt joko Immonen tai Saarakkala.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 12.09.2012, 23:03:20
Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Niin on.

Tämä on suomalaisuuden säilymisen kannalta uhkaavin tilanne sitten Talin-Ihantalan taistelun. Jos tuo maahanmuuttoautomaatti päästetään päälle ja sen kiinni kääntäminen ei enää onnistu, koska "kansainväliset sopimukset", niin Suomi on tuhon oma. Tuho lävistää koko yhteiskunnan ja se on peruuttamaton. Vikaan mennyttä maahanmuuttoa ei voi enää tehdä tekemättömäksi.

Tämän päätöksen puolesta äänestäneiden päättäjien kädet ovat tulevien sukupolvien veressä!

Veri lentää jo aikaisemmin, jos nyt yleensä on lentääkseen. Vai tarkoitaanko tässä halal-teurastajien verta?

Onko tulevia suomalaisia sukupolvia yleensä tulossa tällä menolla, epäilen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: coscarnorth - 12.09.2012, 23:15:15
Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Mietin täysin samaa. Välillä sitä vaan tulee ajateltua sitä, kuinka paljon helpompaa elämä olisi, ellen ikinä olisi herännyt Euroopan islamisaatioon ja hitaaseen itsemurhaan. Seuratessa vierestä, kuinka EU:n ja sen jäsenmaiden poliittinen eliitti vain kiihdyttää tätä tuhoa, valtaa mielen täydellinen epätoivo ja lähes paranoidinen tunne. On se vaan niin surullista, mutta uskon, että mitään ei ole enään tehtävissä. Peli on jo menetetty.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kuvitteellinen hahmo - 13.09.2012, 00:03:54


Lainaus
""In this text we have spelled out what solidarity means in practice: burden sharing between the different Member States. Now we look to the Commission to pass on to us the relevant legislative proposals so that we can continue the work we committed to undertake since 1999", explained rapporteur Kyriacos Triantaphyllides (GUE/NGL, CY) in a debate on Monday evening. His resolution was adopted with 584 in favour, 41 against and 54 abstentions.

Eli aloitteen tekijä on siis GUE/NGL -äärivasemmistolaisesta ryhmästä, johon kuuluu muun muassa Kreikan kommunistinen puolue sekä DDR:n jatkaja Die Linke.

http://en.wikipedia.org/wiki/European_United_Left%E2%80%93Nordic_Green_Left

Melko yksimielinen vastaanotto siihen nähden.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: vilinpoika - 13.09.2012, 12:24:31
Tempora mutanti-ajat muuttuvat. Vuonna 1952 Suomessa oli myös ulkoministeri, nimeltään Tuomioja.  Paasikiven päiväkirjan mukaan(s. 275), hän sanoi: "me emme voi madella ryssien edessä". Sivulla 206, Paasikivi sanoo näin:"Kansa pitäisi saada ymmärtämään vapaudenjärjestelmämme arvo ja merkitys ja pitämään sitä kansamme kalleinpana omaisuutena." Paasikiven puoluetoveri, katainen ei ole näitä viisauksia äidinmaidostaan imenyt, nuolee neuvost....anteeksi, euroopan liittoa, eikä oppi ole periytynyt myöskään Tuomiojan suvussa. Syötetään vaan kansalle paskaa ja väitetään sitä mämmiksi. Sauve qui peut..... ???
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 13.09.2012, 14:41:48


Lainaus
""In this text we have spelled out what solidarity means in practice: burden sharing between the different Member States. Now we look to the Commission to pass on to us the relevant legislative proposals so that we can continue the work we committed to undertake since 1999", explained rapporteur Kyriacos Triantaphyllides (GUE/NGL, CY) in a debate on Monday evening. His resolution was adopted with 584 in favour, 41 against and 54 abstentions.

Eli aloitteen tekijä on siis GUE/NGL -äärivasemmistolaisesta ryhmästä, johon kuuluu muun muassa Kreikan kommunistinen puolue sekä DDR:n jatkaja Die Linke.

http://en.wikipedia.org/wiki/European_United_Left%E2%80%93Nordic_Green_Left

Melko yksimielinen vastaanotto siihen nähden.

No eihän hän kuitenkaan  itsekseen mitään aloitetta ole tehnyt, vaan Kansalaisvapauksien sekä oikeus- ja sisäasioiden valiokunta valitsi hänet valmistelemaan asiasta päätöslauselmaesityksen, joka nyt äänestettiin hyväksytyksi. Kyllähän hänet valitessaan työhön ryhmät tiesivät jo mitä saavat.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Marko M - 13.09.2012, 15:55:22
Joku oli tehnyt tällaisen.

http://www.nbl.fi/~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 13.09.2012, 16:13:43
Joku oli tehnyt tällaisen.

http://www.nbl.fi/~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html

Virolaiset varmaan haltioissaan liki 5 000:sta onnenonkijasta. Prosentuaalinen kasvu verrokkina olevaan 15:sta on melkoinen. Onhan tuo lievästi sanoen hupaisaa että Suomi "saa" yhtäkkiä kantaa suurempaa vastuuta kuin 65 miljoonan asukkaan Ranska (onneksi edes Le Penit vastustivat :D)

Mahtaa siinä olla Algerian poika ihmeissään, kun luuli muuttavansa kotoisaan ranskalaislähiöön ja mitään kysymättä tyyppi lennätetäänkin napapiirille :D
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 13.09.2012, 17:29:51
Virheät siis vaativat CEASin hallitusohjelmaan. Mahtaakohan sen edistäminen olla muille heistä hallituskysymys kuin Joukko-Hautalalle, joka käsittääkseni palasi EU-parlamentidta Suomeen kesken kauden mm. tämän tärkeänä pitämänsä asian takia? Jos siis muilla hallistuspuolueilla olisi järkeä, tämän idioottikohdan yliviivaamisella hallitusohjelmasta päästäisiin samalla Virheistä eroon???  Taitaa olla turha toivo nykykokoomus tai edes KD tässä suhteessa, että panisivat punavihersokeille kovan kovaa vastaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: M13 - 14.09.2012, 01:32:15
Not Found

The requested URL /~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html was not found on this server.


edit: ei löydy Googlen välimuististakaan...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 14.09.2012, 01:47:09
Not Found

The requested URL /~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html was not found on this server.


edit: ei löydy Googlen välimuististakaan...

2010-03-03 Europarlamentti: Yhteinen turvapaikkapolitiikka ja taakanjako (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 14.09.2012, 02:01:08
Niin ne rikkaudet muuttuvat taakoiksi, jopa jargonissa, mutta vastuusta ei sentään luisteta...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 14.09.2012, 02:17:56
Tässä projektissa käy muuten näin ...

(http://api.ning.com/files/JBZnRRxEdSlPXkcs4XvozN83TkdtUTXy-daqx658XWsq61WTl08Nf7lRiviyBWg0NcccGsW4yMaV1I6fEZynXKdL2P2Z40lG/MTV3.png)

Onnea Lontoo, Pariisi, Berliini ja Madrid :flowerhat:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: FadeAway - 14.09.2012, 02:59:44
Taas tämmöistä päätöksentekoa.
EU:n yhteinen pakolaispolitiikka saattaa ehdotuksen mukaan 3-7-kertaistaa Suomen turvapaikanhakijoiden määrän verrattuna viime vuoteen.

Mutta hei! Me tienataan tällä. Ehdotuksessa harkitaan 4000€/mamu tukea EU:n rahastosta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 14.09.2012, 08:08:05
Taas tämmöistä päätöksentekoa.
EU:n yhteinen pakolaispolitiikka saattaa ehdotuksen mukaan 3-7-kertaistaa Suomen turvapaikanhakijoiden määrän verrattuna viime vuoteen.

Mutta hei! Me tienataan tällä. Ehdotuksessa harkitaan 4000€/mamu tukea EU:n rahastosta.

Ei kun me maksetaan tuo 4000 vielä muihinkin maihin siirrettävistä turvapaikanhakijoista :facepalm:

Suomi on EU:ssa nettomaksaja muutenkin, ja CEAS lisännee EU-jäsenmaksujen tarvetta. Jos Suomi sitten haluaa saada jotain rahoja takaisinkinpäin, pitää ottaa entistäkin enemmän vastaan näitä neljätonnisia. Pahaa pelkään, että tällaisiakin perusteluja tullaan käyttämään kunhan ensi on sitouduttu. Toivottavasti samalla muistetaan pitää esillä kokonaiskustannusta per humanitaarinen (mieleeni jäänyt luku 50 000 euroa/vuosi, saa korjata).
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 14.09.2012, 08:14:31
On se vaan niin surullista, mutta uskon, että mitään ei ole enään tehtävissä. Peli on jo menetetty.

Kannattaako suggeroida itsensä pelin menetykseen kesken pelin?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: KTM - 14.09.2012, 08:34:25
Toivottavasti samalla muistetaan pitää esillä kokonaiskustannusta per humanitaarinen (mieleeni jäänyt luku 50 000 euroa/vuosi, saa korjata).

20 000 x 50 000 € / vusoi = Miljardi euroa per vuosi.

Lisäksi kun tulijoita tulee tasaisena virtana viiden vuoden päästä 100 000 tulijan elatus maksaa jo 5 miljardia per vuosi.

Mahtaakohan tuo EU:n 4000 korvaus olla kertakorvaus? Tuskin EU sitoutuu maksamaan tulijoiden elatusta kymmeniä vuosia niin kuin ne todellisuudessa tulevat sosiaalijärjestelmää rasittamaan.

Suomessa apitäisi heti alkaa muuttamaan lainsäädäntöä niin että tulijoiden elatus saa tulla maksamaan vain tuon EUn "antaman" 4000 € eikä yhtään enempää, eli sosiaalituki vain suomen kansalaisille ja lisäksi tulijat sijoitettakoon telttaleiriin, kunnilta ja valtiolta pitää poistaa velvoite heidän asuttamisestaan.

Miksi ihmeessä EU ei kehitä yhteistä pakolaisten ja laittomien siirtolaisten palautusjärjestelmää, sen luulisi olevan paljon tärkeämpi projekti. Taakanjako-ohjelma johtanee vain siihen että etelä-euroopan maat alkavat llaiskottelemaan rajanvalvonnassa ja laittomien siirtolaisten määrä moninkertaistuu.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 14.09.2012, 09:10:25
Toistanpa vielä yhden täällä ehdotetun asian. EU:n yhteisen turvapaikkapolitiikanhan voisi rakentaa niinkin, että suojelu tarjotaan Euroopan ulkopuolelta. Tai jos on pakko tarjota EU-maista, niin monilla on yhä alueita myös Euroopan ulkopuolella. Esim. Grönlanti, Falklandinsaaret, Ranskan Guayana, oliko peräti Espanjan Sahara tuossa Marokon länsipuolella? Tai mitä jos muutettaisiin veroparatiisi Hollannin Antillit mamuparatiisiksi?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: FadeAway - 14.09.2012, 18:21:50
Mitenköhän tämä roudaus toteutetaan. Jos Suomen osuudeksi tästä afrikkalais monikuttuuriprojektista on vaikkapa 1000-2000 pakolaista kuukaudessa?
Ostaako valtio?
a) ruotsinlaivan joka matkustaa välimerelle (Ranskaan, Espanjaan, Kreikkaan tai Italiaan) hakemaan seuraavan saapumiserän.
b) bussiletka esim. 30 bussia ajaa edes takaisin Suomen uusien Holmlund-mallisten yli 1000:n asiakkaan vastaanottokeskusten ja Etelä-Euroopan säilöntäkeskusten välillä
c) vuokrataan muutama lentokone.


Näinä aikoina, kun säästetään ja leikataan puolustusvoimista, poliisilta, koulutuksesta...
Vahingossa(kuten rikkidirektiivi) aloitetaan tällainen hanke, jonka kustannukset varovaisesti on kokoluokkaa satoja miljoonia lyhyellä aikavälillä ja miljardeja keskipitkällä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ketale - 14.09.2012, 18:53:07
Kyllähän keinoja roudaamiseen löytyy.  Tuli mieleen, että jos Suomessa esiintyy tasaamisen suhteen epävarmuutta niin Ranskasta ja muistakin nato maista varmaan löytyy kuljetukseen soveltuvia rahtikoneita joilla siirrot tehdään.  Saattaa olla jopa, että Suomen ei tarvitse maksaa mitään näistä tuontikustannuksista.  Vastassa Helsinki-Vantaalla on tietenkin pienempiä koneita joilla jakelu muualle Suomea toteutetaan.   
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: vilach - 14.09.2012, 19:01:03
Olis tietysti mukavaa, jos Suomen media nostas asian tapetille. Taitaa olla turha sitä toivoo.
Suomen median päätoimittajat ovat maanpettureita.

Kyllä tämä nyt näyttää ja tuntuu entistä pahemmalta. Kansalaiset ei tiedä tästäkään asiasta yhtään mitään.
Aikovatko perussuomalaiset käyttää puoluetukea tähän asiaan?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.09.2012, 00:46:35
Chiara Tamburini riemuitsee kirjoituksessaan EU-parlamentin hyväksymästä mallista EU:n yhteiseksi turvapaikkajärjestelmäksi, sen "solidaarisuudesta" ja "vastuunjaosta", joka toteutuu yhteisellä hakemustenkäsittelyllä ja turvapaikanhakijoiden jakamisella "kuormitetusta" maista "kuormittamattomiin" (eli etenkin Suomeen).

Kirjoituksen lopussa kuitenkin lisää huolestuttavaa tietoa:
Lainaus
Next steps: Parliament calls on the Commission to submit a communication on a framework for the transfer of protection of beneficiaries of international protection and mutual recognition of asylum decisions by 2014. They await as well the adoption of the Commission‘s ”Communication on new approaches concerning access to asylum procedures targeting main transit countries” by 2013.
Flyktingbloggen: Enhanced intra-EU solidarity in the field of asylum (http://www.flyktingbloggen.org/2012/09/enhanced-intra-eu-solidarity-in-the-field-of-asylum/)

Vuodelle 2013 kaavaillaan komission kommunikeaa, jonka tarkoituksena on helpottaa uusilla keinoilla turvapaikkahakemuksen jättämistä. Tähän mennessä monia Euroopan maita on suojellut todella suurilta turvapaikanhakijamääriltä sijanti ja rajavalvonta. Esimerkiksi Kreikka ei ole kovin houkutteleva turvapaikanhakumaa, minkä vuoksi se on lähinnä läpikulkumaa. EU haluaakin muuttaa nykyisen epätasa-arvoisen tilanteen mahdollistamalla turvapaikkahakemusten jättämisen EU-maiden lähetystöihin ympäri maailmaa. Tätä samaa esitettiin jo kolmisen vuotta sitten EU:n ns. Tukholman ohjelman luonnoksessa, mutta se tiputettiin muun muassa Ison-Britannian vaatimuksesta pois lopullisesta versiosta. Mutta nyt asia näköjään taas etenee, kun CEAS on saatu alta pois.

Vuonna 2014 puolestaan pitäisi saada tarkemmat nuotit turvapaikanhakijoiden sijoittamisperusteisiin eli tosin sanoen pitäisi lyödä lukkoon jäsenmaiden turvapaikanhakijakiintiöt ja turvapaikanhakijoista maksettavat korvaukset sekä vastaavasti jäsenmaiden uudet maksut pakolaisrahastolle, näin tuon ymmärrän.

Lainaus
We were also successful in inserting significant caveats around a proposal to explore "new approaches concerning access to asylum procedures targeting main transit countries, such as protection programmes for particular groups or certain procedures for examination of applications for asylum" (6.2.3). We were concerned that this would mean that asylum claims could be lodged at consular posts outside the EU; we successfully argued for any such measure to happen on a voluntary basis only, and there is now no explicit mention of consular protection.
House of Lords: 25TH REPORT: THE STOCKHOLM PROGRAMME: HOME AFFAIRS  (http://www.publications.parliament.uk/pa/ld200910/ldselect/ldeucom/102/102we17.htm)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 15.09.2012, 01:01:17
Jos nyt ihan realisteja ollaan, niin CEAS:in toteutuessa en usko taakanjakopolitiikan toteutuvan ainakaan siten, että turvapaikanhakijat ripoteltaisiin tasaisesti eri maihin. Suomi lienee kuitenkin sen verran tiukkana jopa nykyisellä hallituksella, että ei voi sitä hyväksyä. Puolestaan koko juttu voi tulla Suomelle hyvin kalliiksi myös sillä tavalla, että Suomi joutuu maksamaan kovia summia tuohon solidaarisuusrahastoon. Paras ratkaisu olisi tietenkin, että Suomi jättäytyisi koko järjestelmän ulkopuolelle, mutta ei taida olla mahdollista nykyhallituksella.

Pakko muuten sanoa, että jos CEAS toteutuu Suomelle kallillla tavalla, niin siitä voi hyvinkin syyttää myös Perussuomalaisia. Jos PS olisi mennyt hallitukseen, niin Suomi olisi jo ajat sitten irtisanoutunut taakanjaosta ja siitä, että pakolaispolitiikassa annettaisiin valta EU:lle.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 15.09.2012, 01:43:58
Jahah, PS kieltäyi muiden puoluiden perinteiseen tapaan pettämästä vaalilupauksiaan. Soini kieltäytyi kaikista myönnytyksistä huolimatta lähtemään vedätettäväksi syntipukiksi. Hänellehän luvattiin mitä?

Aikamoinen utopia, että Soini, Hakkarainen ja Halla-aho olisivat kyenneet lopettamaan hallituksen osallistumisen aikoja sitten sovittuihin taakanjakoihin ja mokutuksiin.

Olisi vain uskottavuus mennyt.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 15.09.2012, 01:50:04
Jos nyt ihan realisteja ollaan, niin CEAS:in toteutuessa en usko taakanjakopolitiikan toteutuvan ainakaan siten, että turvapaikanhakijat ripoteltaisiin tasaisesti eri maihin. Suomi lienee kuitenkin sen verran tiukkana jopa nykyisellä hallituksella, että ei voi sitä hyväksyä. Puolestaan koko juttu voi tulla Suomelle hyvin kalliiksi myös sillä tavalla, että Suomi joutuu maksamaan kovia summia tuohon solidaarisuusrahastoon. Paras ratkaisu olisi tietenkin, että Suomi jättäytyisi koko järjestelmän ulkopuolelle, mutta ei taida olla mahdollista nykyhallituksella.

Pakko muuten sanoa, että jos CEAS toteutuu Suomelle kallillla tavalla, niin siitä voi hyvinkin syyttää myös Perussuomalaisia. Jos PS olisi mennyt hallitukseen, niin Suomi olisi jo ajat sitten irtisanoutunut taakanjaosta ja siitä, että pakolaispolitiikassa annettaisiin valta EU:lle.

Tervetuloa vaan ne 50 000 mamua savimajoista Suomen metsiin havumajoihin. Jos se jakoperuste oli pinta-ala, huomaavaat kesän tullen jäiden lähtevän ja soiden sulavan.

Vaihtoehtona Dubain öljyrahoilla 140-kerroksisia torneja Rastilan leirintä-alueelle. Kyllä kaikki ruokitaan, kunhan rahaa tulee. Saavat minunpuolestani joikhatakkin sopivaan hintaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.09.2012, 01:54:36
Jos nyt ihan realisteja ollaan, niin CEAS:in toteutuessa en usko taakanjakopolitiikan toteutuvan ainakaan siten, että turvapaikanhakijat ripoteltaisiin tasaisesti eri maihin.

Ei turvapaikanhakijoita ole missään vaiheessa aiottu "ripotella tasaisesti". Avainsana on solidaarisuus. Suomesta kaavaillaan turvapaikkasijoitusten kärkimaata Ruotsin ohella.

Lainaus
Suomi lienee kuitenkin sen verran tiukkana jopa nykyisellä hallituksella, että ei voi sitä hyväksyä.

Miksi olisi tiukkana? Ensin hyväksytään vähin äänin periaate uudelleensijoituksista (hallitus on ollut koko ajan tietoinen suunnitelmista ja kannattanut niitä), ja kiintiökaavoja rukataan vasta seuraavan hallituksen aikana aiotulle tasolle. Sitten levitellään käsiä, että näin pääsi käymään, ei voi enää mitään.

Lainaus
Puolestaan koko juttu voi tulla Suomelle hyvin kalliiksi myös sillä tavalla, että Suomi joutuu maksamaan kovia summia tuohon solidaarisuusrahastoon.

Suomi maksaa, tavalla ja toisella. Jonkunhan täytyy välttämättä maksaa uudelleensijoitusmyllyn käynnistys ja ylläpitäminen, sillä ei se itsestään pysyisi pystyssä. Kun rahat saadaan virtaamaan, ei järjestelmää voida enää purkaa, koska joka maassa tuhannet työntekijät ovat riippuvaisia EU-rahavirroista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 15.09.2012, 01:55:07
Jahah, PS kieltäyi muiden puoluiden perinteiseen tapaan pettämästä vaalilupauksiaan. Soini kieltäytyi kaikista myönnytyksistä huolimatta lähtemään vedätettäväksi syntipukiksi. Hänellehän luvattiin mitä?

Aikamoinen utopia, että Soini, Hakkarainen ja Halla-aho olisivat kyenneet lopettamaan hallituksen osallistumisen aikoja sitten sovittuihin taakanjakoihin ja mokutuksiin.

Olisi vain uskottavuus mennyt.

Olen tästä hallituskysymyksestä niin paljon keskustellut, että en jaksa nyt kovin syvällisesti perustella mitään, mutta tiivistetään olennaisimmat asiat lyhyesti vaikkapa ranskalaisin viivoin:

- PS:n ollessa hallituksessa se olisi ollut erittäin vaikutusvaltainen ja esimerkiksi Suomen maahanmuuttopolitiikkaa oltaisiin kiristetty huomattavasti; tähän oli kesäkuun alussa tarjolla myös paras mahdollinen hallituspohja kok-ps-kesk, mutta ei kelvannut persuille.
- Mitä järkeä jäädä oppositioon, kun tukipaketit menevät joka tapauksessa läpi? Lisäksi oppositioon jäännillä menetettiin kaikki vaikutusvalta kaikkeen muuhunkin. Sitä paitsi hallituksesta oltaisiin pystytty vaikuttamaan tukipaketteihinkin paremmin kuin oppositiosta.
- Jääminen oppositioon kaiken päätöksenteon ulkopuolelle se vasta todellinen takinkääntö olikin.
- Mieti tykönäsi kumpi on pahempi: tukipaketit, jotka ovat vain rahaa vai holtiton maahanmuuttopolitiikka, joka pahimmillaan tuhoaa koko suomalaisen yhteiskunnan?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 15.09.2012, 02:11:30
Just joo, kas kun keskustapuolue saa ihan rauhassa olla oppositiossa vaikka on ollut näitä mokutuksia ja tukia rakentelemassa.

Yllätysvoiton saanut PS teki viisaasti jäämällä keskustan rinnalle riittävän voimakkaan opposition aikaansaamiseksi.

Hallituspuolueet ovat valehtelemalla ja sinisilmäisyydellä vieneet maan yhä syvemmälle EU-suohon.

Mikähän olisi ollut se hallituskokoonpano, johon olis PS:stä löytynyt ministereitä ja voimaa muuhun kuin syntipukin asemaan.

Nyt saavat Katainen, Urpilainen ja Stubb syödä oman soppansa siipipuolueidensa rukoillessa på svenska.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 15.09.2012, 02:16:08
Suomi lienee kuitenkin sen verran tiukkana jopa nykyisellä hallituksella, että ei voi sitä hyväksyä.

Miksi olisi tiukkana? Ensin hyväksytään vähin äänin periaate uudelleensijoituksista (hallitus on ollut koko ajan tietoinen suunnitelmista ja kannattanut niitä), ja kiintiökaavoja rukataan vasta seuraavan hallituksen aikana aiotulle tasolle. Sitten levitellään käsiä, että näin pääsi käymään, ei voi enää mitään.


No olen saanut tämän käsityksen muun muassa seuraavien asioiden takia:

1) Jussi Halla-ahon viesti Hommaforumilla asiaan liittyen:

...
Kannattaa myös huomioida, että suurelta osin perussuomalaisten aiheuttaman paineen vuoksi tämänhetkinen tilanne ei ole yhtä katastrofaalinen ja kriittinen kuin se oli Thorsin valtakaudella. Suomi on käytännössä vetänyt hyvin tiukkaa linjaa esimerkiksi EU:n yhteisen turvapaikkapolitiikan ja taakanjakomallien suhteen. Se, että joku kansliapäällikkö Viljanen järjestää monikulttuuriseminaarejaan, on toki ärsyttävää mutta toissijaista.

2) Vesa-Matti Saarakkalan kirjallinen kysymys EU:n yhteisestä turvapaikkapolitiikasta ja sisäministeri Räsäsen vastaus siihen (http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_211_2012_p.shtml)

Lainaus käyttäjältä:  Päivi Räsänen
...
Parhaillaan neuvotellaan yhteistä turvapaikkajärjestelmää koskevien EU-säädösten muuttamisesta. Komission alkuperäiset muutosehdotukset sisälsivät useita tervetulleita korjauksia, mutta myös sellaista, mitä Suomi ei voinut kannattaa. Erityisen hankala Suomelle ja valtaosalle jäsenvaltioista oli Dublin-siirtojen tilapäistä keskeyttämistä koskenut komission ehdotus. Komissio ei kuitenkaan päätä lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden ja Euroopan parlamentin kanssa. Jäsenvaltioiden vastustuksen vuoksi mainittu ehdotus on sittemmin korvattu niin sanotulla varhaista varautumista koskevalla menettelyllä, jolla arvioidaan jäsenvaltioiden turvapaikkamenettelyjen kestävyyttä. Vaikka menettelystä säätäminen vastuunmäärittämis-asetuksessa ei olekaan paras ratkaisu, menettely sinänsä on hyvä väline nostaa ajoissa mahdolliset jäsenvaltioiden turvapaikkajärjestelmien ongelmat keskusteltavaksi EU-tasolla ja pyrkiä puuttumaan niihin ennen kuin tilanne vaikeutuu. Jatkossa ehkä voidaan välttää Kreikan turvapaikkajärjestelmän tämän hetken kriisiä vastaavat tilanteet.

Vaikka yhteinen turvapaikkajärjestelmä on Suomelle hyvin tärkeä tavoite, siihen ei olla pyrkimässä millä hinnalla hyvänsä. Tällä hetkellä käsiteltävissä EU:n turvapaikkalainsäädäntöä koskevissa muutosehdotuksissa ei kuitenkaan ole mitään sellaista, minkä vuoksi Suomi ei voisi olla mukana niiden valmistelussa. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa vaikutamme ja olemme jo vaikuttaneet hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

3) Kansanedustaja Arto Satosen vastaus minulle, kun tiedustelin häneltä sähköpostitse Suomen kantaa EU:n yhteiseen turvapaikkapolitikkaan.

Lainaus käyttäjältä:  Arto Satonen
Missään nimessä Suomella ei ole tarkoitus hyväksyä sellaista yhteistä turvapaikan hakijoiden taakanjakoa, joka toisi meille yhtä paljon turvapaikanhakijoita, kuin esimerkiksi etelä-Euroopan maihin. Tosin meillä on iso naapuri itselläkin vieressä ja toivoa sopii, että siellä asiat hoituvat sen verran hyvin, että ei tule tarvetta lähteä isolla joukolla liikkeelle. Kuten varmaan hyvin tiedät turvapaikanhakijoiden määrät ovat huomattavasti alentuneet niillä toimilla, joita edellinen hallitus teki. 

Toki yllä olevissa viesteissä on paljon tulkinnan varaa, mutta ainakin se käsitys tulee, että ei nyt ainakaan ihan hinnalla millä hyvänsä kuitenkaan. Mutta eihän sitä toki tiedä sitten, onhan sitä ennenki sanottu toista ja tehty toista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 15.09.2012, 02:26:53
Yllätysvoiton saanut PS teki viisaasti jäämällä keskustan rinnalle riittävän voimakkaan opposition aikaansaamiseksi.

Minkä ihmeen yllätysvoiton? Eiköhän PS:n ryminävoitto ollut kaikkien tiedossa. Ja siis mitä? "Riittävän voimakkaan opposition saamiseksi"? No huhhuh. Mitä merkitystä sillä PS:n voitolla edes on, kun jäätiin oppositioon? Ja mieti mikä merkitys olisi ollut, jos olisi mennyt hallitukseen.

Hallituspuolueet ovat valehtelemalla ja sinisilmäisyydellä vieneet maan yhä syvemmälle EU-suohon.

No hallituksesta PS olisi voinut paremmin vaikuttaa vaikka kusetusvakuuksiin ja muihin juttuihin. EU-politiikkaan kuuluu myös paljon muuta kuin tukipaketit ja emu-politiikka; esimerkiksi rikkidirektiivi, EU:n yhteinen turvapaikkapolitiikka ja EU:n laajentuminen näin hyvinä esimerkkeinä.

Lainaus
Mikähän olisi ollut se hallituskokoonpano, johon olis PS:stä löytynyt ministereitä ja voimaa muuhun kuin syntipukin asemaan.

Vaihtoehdot olivat kok-sdp-ps ja kok-ps-kesk. Molemmissa PS olisi ollut voimakas vaikuttaja. PS:n hallituskokoonpano olisi kyllä löytynyt, esmes seuraava: Soini valtiovarainministeri tai elinkeinoministeri (riippuen hallituspohjasta), Vistbacka sisäministeri, Havansi oikeusministeri, Mäkipää kuntaministeri, Niinistö puolustusministeri (+ muitakin salkkuvaihtoehtoja olis voinu olla, esmes Virtanen kulttuuriministeri, Lerner asuntoministeri jne.)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 15.09.2012, 02:44:56
Oisko tässä nyt sitten syy olla äänestämättä perussuomalaisia, kun ainakin  minulle yllätyksenä tullut "jytky" ei välitöntä valtakunnanpolitiikan käännöstä tuonutkaan? Painetta toivottavasti loi.

Ei valtiolaivan ja virkamiesvallan suuntaa muuteta jollain hetkelliseksi arvellulla 20% äänimäärällä. Mepit jauhaa paskaa ja kansaa kusetetaan.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.09.2012, 02:56:53
Kannattaa myös huomioida, että suurelta osin perussuomalaisten aiheuttaman paineen vuoksi tämänhetkinen tilanne ei ole yhtä katastrofaalinen ja kriittinen kuin se oli Thorsin valtakaudella. Suomi on käytännössä vetänyt hyvin tiukkaa linjaa esimerkiksi EU:n yhteisen turvapaikkapolitiikan ja taakanjakomallien suhteen. Se, että joku kansliapäällikkö Viljanen järjestää monikulttuuriseminaarejaan, on toki ärsyttävää mutta toissijaista.

Suomi on kaikissa virkamiesten kommenteissa sekä edellisen että nykyisen hallituksen aikana kannattanut EU:n yhteistä turvapaikkajärjestelmää. Taakanjakomalleista en muista mainitun näissä yhteyksissä yhtään mitään. Jos Halla-aholla on jotain sisäpiirin tietoa uusista tiukemmista linjauksista ja kategorisesta taakanjaosta kieltäytymisestä, soisin niiden tulevan pian yleiseen tietoon esimerkiksi ministeri Räsäsen kautta.

Lainaus käyttäjältä:  Päivi Räsänen
Vaikka yhteinen turvapaikkajärjestelmä on Suomelle hyvin tärkeä tavoite, siihen ei olla pyrkimässä millä hinnalla hyvänsä. Tällä hetkellä käsiteltävissä EU:n turvapaikkalainsäädäntöä koskevissa muutosehdotuksissa ei kuitenkaan ole mitään sellaista, minkä vuoksi Suomi ei voisi olla mukana niiden valmistelussa. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa vaikutamme ja olemme jo vaikuttaneet hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

Räsänen ei ota kantaa taakanjakoon, eikä täsmennä, mitä yhteisen turvapaikkajärjestelmän ominaisuuksia Suomi mahdollisesti ei hyväksyisi. Ilmeisesti ainakin taakanjako on Räsäselle ok, koska hän ilmoittaa hyväksyvänsä muutosehdotukset, joista taakanjako on ollut vuosikausia yksi tärkeimmistä.

Lainaus käyttäjältä:  Arto Satonen
Missään nimessä Suomella ei ole tarkoitus hyväksyä sellaista yhteistä turvapaikan hakijoiden taakanjakoa, joka toisi meille yhtä paljon turvapaikanhakijoita, kuin esimerkiksi etelä-Euroopan maihin.

Satonen on rivikansanedustaja. Kukaan ministeri tai korkea virkamies ei ole asettanut edes tällaisia ehtoja. Eikä muuten mitään muitakaan ehtoja. Satonenkaan ei torju taakanjaon periaatetta, kunhan tulijoita ei ole "liikaa". Ilmeisesti tulijamäärän tuplaus tai triplaus olisi vielä hyväksyttävissä.

Lainaus
Toki yllä olevissa viesteissä on paljon tulkinnan varaa, mutta ainakin se käsitys tulee, että ei nyt ainakaan ihan hinnalla millä hyvänsä kuitenkaan. Mutta eihän sitä toki tiedä sitten, onhan sitä ennenki sanottu toista ja tehty toista.

Halla-ahon ja Satosen henkilökohtaisilla mielipiteillä ja käsityksillä ei ole tässä juuri merkitystä. Ministeri Räsänen taas ei sano asiasta mitään konkreettista, mutta antaa ymmärtää, että Suomi on vaikuttamisensa vaikuttanut ja hyväksyy tulevat muutosesitykset. En tiedä, mikä tuo "hinnalla millä hyvänsä"-vaihtoehto on, mutta minusta Suomi näyttää periaatetasolla hyväksyvän turvapaikanhakijoiden uudelleensijoittamisen ja hakemusten yhteisen käsittelyn. Hyväksynnän jälkeen ei paluuta ole, vaan samalla sitoudutaan turvapaikanhakijamäärän ja/tai pakolaisrahastomaksujen kasvamiseen, jos EU:n "neutraali" distribution key (http://www.timesofmalta.com/articles/view/20120911/local/euro-parliament-proposes-distribution-key-for-relocation-of-migrants.436538) -kaava niin käskee.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 15.09.2012, 03:09:17
Halla-ahon ja Satosen henkilökohtaisilla mielipiteillä ja käsityksillä ei ole tässä juuri merkitystä.

No tuskin Halla-aho tuollaista täällä väittäisi, jos sillä ei mitään perää olisi. Kyllä hän varmaan jotain kuitenkin tietää hallituksenkin linjauksista, kun on toiminut hallintovaliokunnassa ja viestin kirjoittamishetkellä vieläpä puheenjohtajana. Satosta taas en välttämättä pitäisi pelkkänä rivikansanedustajana, sillä käytännössä hän on vastannut viime vuosina kokoomuksen maahanmuuttopoliittisesta linjasta ja esimerkiksi hallitusneuvotteluissa toimi sisäisen turvallisuuden työryhmän yhtenä jäsenenä. Luulisi siis hänelläkin jonkinnäköistä tietopohjaa olevan.

En tiedä, mikä tuo "hinnalla millä hyvänsä"-vaihtoehto on, mutta minusta Suomi näyttää periaatetasolla hyväksyvän turvapaikanhakijoiden uudelleensijoittamisen ja hakemusten yhteisen käsittelyn. Hyväksynnän jälkeen ei paluuta ole, vaan samalla sitoudutaan turvapaikanhakijamäärän ja/tai pakolaisrahastomaksujen kasvamiseen, jos EU:n "neutraali" distribution key (http://www.timesofmalta.com/articles/view/20120911/local/euro-parliament-proposes-distribution-key-for-relocation-of-migrants.436538) -kaava niin käskee.

Kyllähän sen voi kansallisen parlamentin päätöksellä kumota, mutta olisi tosiaan erittäin tärkeää, että Suomi ei menisi hyväksymään tuota.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.09.2012, 10:13:21
Kyllähän sen voi kansallisen parlamentin päätöksellä kumota, mutta olisi tosiaan erittäin tärkeää, että Suomi ei menisi hyväksymään tuota.

Tämähän menee siihen tyypilliseen tapaan, että muutokset hyväksytään neuvoteltuna, yksityiskohdiltaan vielä epämääräisenä pakettina, johon ei enää voi tehdä muutoksia. Turvapaikanhakijakiintiöitä (distribution key), hakemusten yhteiskäsittelya ja päätösvallan siirtämistä pois jäsenvaltioilta ei ole vielä siinä vaiheessa (2013-2014) lyöty täysin lukkoon, jottei hankkeen vastustajille annettaisi aseita käsiin. Ne sovitaan myöhemmin, kun CEASin toteutus on periaatetasolla hyväksytetty.

Jos Suomi oikeasti vastustaisi "taakanjakoa", olisi se jo ilmennyt jollain tavalla. Nyt edetään samalla tavalla hiljaa hiipien kuin Thors vuoden 2009 ulkomaalaislain uudistuksensa kanssa. Se oli mukamas "kansainvälisten sopimusten" vaatimaa, eikä Suomi voinut sille mitään.

Lainaus
Satosta taas en välttämättä pitäisi pelkkänä rivikansanedustajana, sillä käytännössä hän on vastannut viime vuosina kokoomuksen maahanmuuttopoliittisesta linjasta ja esimerkiksi hallitusneuvotteluissa toimi sisäisen turvallisuuden työryhmän yhtenä jäsenenä. Luulisi siis hänelläkin jonkinnäköistä tietopohjaa olevan.

Satonen tuntuu hyväksyvän taakanjaon, kunhan tulijoita ei ole "yhtä paljon kuin Etelä-Euroopan maissa". Ei mikään tiukka kanta, vaan juuri sellaista myötäilyä ja kiertelyä, mitä ei nykytilanteessa haluaisi kuulla pääministeripuolueen maahanmuuttoasiantuntijalta.

Lainaus käyttäjältä: Arto Satonen
Missään nimessä Suomella ei ole tarkoitus hyväksyä sellaista yhteistä turvapaikan hakijoiden taakanjakoa, joka toisi meille yhtä paljon turvapaikanhakijoita, kuin esimerkiksi etelä-Euroopan maihin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 15.09.2012, 20:51:42
Toverit hommarit, olisiko tästä asiasta mielekästä viritellä nimienkeruuta nykyisen perustuslain mahdollistamaa kansanäänestystä varten. Pidettäisiin ainakin melua ... TV-spotit olisivat kyllä hyvä kohde myös PS:n puoluetukimiljoonille ...

Edit: piti puhumani siitä uudesta 50 000 nimen kansalaislakialoitteesta. Toki kansanäänestystäkin voisi yrittää vaatia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jouko - 15.09.2012, 20:56:48
Nämä yhteisvastuuasiat menevä täysin överiksi alalla kuin alalla. Se tarkoittaa vain sitä että joudumme kantamaan vastuuta toisten suhmuroinneista ilman että mitenkään voimme siihen vaikuttaa saatikka estää sitä.
 :facepalm:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Sakari - 16.09.2012, 00:59:30
Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Mietin täysin samaa. Välillä sitä vaan tulee ajateltua sitä, kuinka paljon helpompaa elämä olisi, ellen ikinä olisi herännyt Euroopan islamisaatioon ja hitaaseen itsemurhaan. Seuratessa vierestä, kuinka EU:n ja sen jäsenmaiden poliittinen eliitti vain kiihdyttää tätä tuhoa, valtaa mielen täydellinen epätoivo ja lähes paranoidinen tunne. On se vaan niin surullista, mutta uskon, että mitään ei ole enään tehtävissä. Peli on jo menetetty.

Äläs nyt. Niin kauan kuin han suomalaisia lasketaan miljoonissa, on meillä toivoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 16.09.2012, 01:19:23
Tuon esityksen puolesta äänestäminen tai äänestämättä jättäminen on maanpetos.

Mietin täysin samaa. Välillä sitä vaan tulee ajateltua sitä, kuinka paljon helpompaa elämä olisi, ellen ikinä olisi herännyt Euroopan islamisaatioon ja hitaaseen itsemurhaan. Seuratessa vierestä, kuinka EU:n ja sen jäsenmaiden poliittinen eliitti vain kiihdyttää tätä tuhoa, valtaa mielen täydellinen epätoivo ja lähes paranoidinen tunne. On se vaan niin surullista, mutta uskon, että mitään ei ole enään tehtävissä. Peli on jo menetetty.

Äläs nyt. Niin kauan kuin han suomalaisia lasketaan miljoonissa, on meillä toivoa.

Sitäpaitsi kyllä routa ... eh ... "porsaan" kotiin ajaa. Routa tulossa, koska mokuklusteri.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Mursu - 16.09.2012, 01:59:23
Minä en ymmärrä mitä ihmeen tekemistä pinta-alalla on asian kassa? Lisäksi jo otetaan vielä asukastiheys, niin pinta-ala lasketaan kahteen kertaan. Pinta-ala voisi olla oleellinen, jos porukka pantaisiin Karjalan evakkojen tapaan ravaamaan itselleen pientilat korpeen, mutta kun heidät otetaan veronmaksajien eläteiksi, ei sillä ole mitään merkitystä.

Luontevinta olisi, että kiintiö menisi siinä suhteessa, jossa kullakin maalla on edustajia europarlamentissa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 16.09.2012, 02:30:02
Minä en ymmärrä mitä ihmeen tekemistä pinta-alalla on asian kassa? Lisäksi jo otetaan vielä asukastiheys, niin pinta-ala lasketaan kahteen kertaan. Pinta-ala voisi olla oleellinen, jos porukka pantaisiin Karjalan evakkojen tapaan ravaamaan itselleen pientilat korpeen, mutta kun heidät otetaan veronmaksajien eläteiksi, ei sillä ole mitään merkitystä.

Luontevinta olisi, että kiintiö menisi siinä suhteessa, jossa kullakin maalla on edustajia europarlamentissa.

Kun meille tarjotaan kahta huonoa vaihtoehtoa, huonompi alkaa luontevan oudosti vaikuttaa hyvältä.

Mutta jos et pelaa, et voi hävitä.

Jos jättää valitsematta huonomman vaihtoehdon ja sanoo "ei" molemmille huonoille vaihtoehdoille, on luonnonoikku, edistyksen vastustaja.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 16.09.2012, 07:13:47
Mitä helvettiä on tekeillä? "Liekit löivät vihan perjantaina" kirjoittaa HS

Haluammeko todella liittyä tämmöiseen islamilaiseen maailmaan?

Ministeri Räsänen, KD, ajaa Suomea kohti kuviteltua valloittajien ja vallattujen yhteiseloa.

Ilmitulleet ovat nyt tämä ulkoistettava pakolaisista päättäminen ja liikkuvan poliisin lopettaminen.

Maailman pakolaisten massapakko-otto Suomeen tuottaa sisällissodan, siitä syylliset ovat uskonsa mukaisesti ristiinnaulittava.

Mitähän muuta kansalle tuhoisaa, mutta joillekkin edullista esitystä solutettu politiikko keksii uuden virkansa lunnaiksi.

Onko esitetty mitään syitä LP:n lopettamiseksi, paitsi kuvitellut säästöt. Mahdollinen käyttö maahanmuuttajien mellakoinnin ja riehunnan hillitsemiseen on varmaan turha argumentti.

Tätä iloisen tempperamenttista ja kultturellia uskovaisten joukkoa kun nyt kiihottavat herkästi lähes kaikki, mitä Kairon suurmufti tms. määrää. Turpa kiinni tai lähetystöt palaa ja partaniekat hilluu toreilla.

Toimiiko LP huonosti, tehottomasti tai onko osoitettu sen olevan suorituksiinsa nähden liian kallis väline kuitenkin pitkien välimatkojen maassamme.

Mitä mieltä on Liikenneturva?

Puolustusvoimat vähentää kiinteitä yksiköitään ja panostaa liikkuvuuteen.

Poliisi väittää ainakin säilyttävänsä paikalliset poliisiasemat.

Sinnekkö ne entiset liikkuvan poliisin henkilöt hajasijoitetaan?

Tässä tapauksessa tiedon puute lisää tuskaa.
LP:n auton eilen viimeksi näin tien päällä, oisko sitten ollut se viimeinen kerta?

Jos olisin saanut olla päättämässä, olisin lisännyt LP:n resurssit sellaiseen mittaan, että poliisi olisi joustavasti voinut näyttää läsnäolonsa suunnitellusti tarpeen mukaan.

Asia on ihan pihvi, jos LP:n henkilöstö ja kalusto siirretaään Ulkomaalaipoliisin alaisuuteen.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 16.09.2012, 08:12:09
Toverit hommarit, olisiko tästä asiasta mielekästä viritellä nimienkeruuta nykyisen perustuslain mahdollistamaa kansanäänestystä varten. Pidettäisiin ainakin melua ... TV-spotit olisivat kyllä hyvä kohde myös PS:n puoluetukimiljoonille ...

Edit: piti puhumani siitä uudesta 50 000 nimen kansalaislakialoitteesta. Toki kansanäänestystäkin voisi yrittää vaatia.

TV-spotit ovat tosiaan hyvä ajatus. Itselleni tuli mieleen, että Perussuomalaisten tulisi pikaisesti painattaa pieni lehti tai tiedote siitä, mitä kansan selän takana jälleen ollaan puuhaamassa - tällä kertaa Suomen lopulliseksi tuhoksi. Tuota lehteä pitäisi painaa noin miljoona kappaletta ja sitä pitäisi levittää aktiivien toimesta ( itsekin lupaudun mukaan ) kaduilla sekä jakaa postilaatikoihin kautta Suomen.

On aivan selvää, että tämä rasistinen CEAS-hanke tulee johtamaan sisällisotiin, nälkään ja kurjuuteen kautta Euroopan. Yksikään koti Suomessa ei saa olla tietämätön tästä kansojen joukkotuhonnan aikeesta. Ja jos tämä menee Suomessa läpi, seuraava vaihe järjen maassamme palauduttua on alkaa vastustaa sitä yksinkertaisesti ilmoittamalla, että Suomi eroaa tästä projektista ( tai mieluiten koko EU:sta ). Niin kauan kuin Suomella on oma armeija ja kansalla tahto elää oman kulttuurinsa eli oman arvojärjestelmänsä puitteissa, meillä on vielä toivoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Marko M - 16.09.2012, 09:21:33
http://fi.wikipedia.org/wiki/Jugoslavian_hajoamissodat

Ehkä tämä on myös Suomen tulevaisuus.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 16.09.2012, 09:35:16
http://fi.wikipedia.org/wiki/Jugoslavian_hajoamissodat

Ehkä tämä on myös Suomen tulevaisuus.

En jaksa uskoa, Suomessas ei ole samalla tavalla etnisiä tai uskonnollisia väestöryhmiä monisata ja jopa tuhatvuotisine skismoineen kuin oli ex-jugoslaviassa. Nämä Suomen uudet etnoryhmät ovat kuitenkin niin hajanaisia ja taikaseinän mennessä rikki enemmistö pakannee kamansa, loput kuolevat sitten nälkään tai sopeutuvat uuteen tilanteeseen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Arvoton - 16.09.2012, 12:41:30
Sortsi, että rönsyilen, mutta topicin pohjalta. Meikällä alkaa mennä ajatukset pikku hiljaa siihen suuntaan, että maamme saisi kohteliaasti poistua Euroopan unionista. Ensin ainakin eurosta. Siinä ei pitäisi olla mitään moraalitonta, koska Suomi liittyi (ilman kansanäänestystä, jopa) euroon sen ehdot täyttäneenä ja hyvässä uskossa, että euroyhteisö on toimiva ja yhtä rehti kuin itse. Haloo! Meidät on ihan selkeästi petetty!

En ymmärrä, että maan hallitsijat haluavat, että tästä maasta on tehtävä sekoitus taloudeltaan Alppien eteläpuolisesta Euroopasta ja väestöltään Saharan eteläpuolisesta Afrikasta. No, onneksi tulevaisuudessa bussit kulkevat ja mun perse pyyhitään viimeiset kaksi kuukauttani sitten joskus.

Euroopasta on tullut taloudellisesti, yhteiskunnallisesti ja moraalisesti puolen maanosan kokoinen lietelammikko. Enää vituttaa vain, että se istuu jenkkien turvallisissa helmoissa. Ilman sitä se olisi kohta osa Venäjää ja myöhemmin osa Kiinaa. Tai saas nähdä, kuinka kauan jenkkipoika porskuttaa. Eiköhän sekin ole kohta lattarimaa ja pelkkää fiestaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: foobar - 16.09.2012, 12:45:04
http://fi.wikipedia.org/wiki/Jugoslavian_hajoamissodat

Ehkä tämä on myös Suomen tulevaisuus.

En jaksa uskoa, Suomessas ei ole samalla tavalla etnisiä tai uskonnollisia väestöryhmiä monisata ja jopa tuhatvuotisine skismoineen kuin oli ex-jugoslaviassa. Nämä Suomen uudet etnoryhmät ovat kuitenkin niin hajanaisia ja taikaseinän mennessä rikki enemmistö pakannee kamansa, loput kuolevat sitten nälkään tai sopeutuvat uuteen tilanteeseen.

Taikaseinä menee tosin rikki vasta, kun yhteiskunta - eli Suomen tapauksessa julkinen talous - on kuralla. Jos meillä pystyttiin käynnistämään somalien kurpitsavankkuriprojekti syvimmässä lamassa, ei liene pelkoa että ennen valtion konkurssia sen vetovoimatekijöitä voitaisiin ainakaan heikentää.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.09.2012, 13:58:50
Minä en ymmärrä mitä ihmeen tekemistä pinta-alalla on asian kassa? Lisäksi jo otetaan vielä asukastiheys, niin pinta-ala lasketaan kahteen kertaan.

Distribution key onkin pelkkää silmänlumetta, jolla yritetään muotoilla poliittinen tavoite siirtää turvapaikanhakijoita suurista jäsenmaista muualle muka neutraaliksi "taakanjaon" kaavaksi. Kaavassa on tarpeeksi liikkuvia osia, jotta kaikkia (väkiluvultaan) isoja maita tyydyttävä lopputulos saadaan lopulta aikaan. Pienille maille lopputulos myydään vääntämällä rahahanat täysille.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Sakari - 16.09.2012, 15:10:21
http://fi.wikipedia.org/wiki/Jugoslavian_hajoamissodat

Ehkä tämä on myös Suomen tulevaisuus.

En jaksa uskoa, Suomessas ei ole samalla tavalla etnisiä tai uskonnollisia väestöryhmiä monisata ja jopa tuhatvuotisine skismoineen kuin oli ex-jugoslaviassa. Nämä Suomen uudet etnoryhmät ovat kuitenkin niin hajanaisia ja taikaseinän mennessä rikki enemmistö pakannee kamansa, loput kuolevat sitten nälkään tai sopeutuvat uuteen tilanteeseen.

Taikaseinä menee tosin rikki vasta, kun yhteiskunta - eli Suomen tapauksessa julkinen talous - on kuralla. Jos meillä pystyttiin käynnistämään somalien kurpitsavankkuriprojekti syvimmässä lamassa, ei liene pelkoa että ennen valtion konkurssia sen vetovoimatekijöitä voitaisiin ainakaan heikentää.

Onhan se nähty toki, että viimeisenä säästetään mamuteollisuudesta, yms. oheiskrääsästä. Eli etnisillä suomalaisilla menee tovin aikaa kurjasti, ennen taikaseinän rikkoutumista mamuilta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Leijona78 - 16.09.2012, 17:28:43
Not Found

The requested URL /~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html was not found on this server.


edit: ei löydy Googlen välimuististakaan...


Kyllä se Googlen välimuistista löytyy. (http://webcache.googleusercontent.com/search?q=cache:zqebTZxRoXIJ:www.nbl.fi/~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html+http://www.nbl.fi/~nbl4149/j7jdhjdzxsd/eu-pakolaissuunnitelma-2010.html&cd=1&hl=en&ct=clnk)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 16.09.2012, 18:25:11
Löytyi, ja koko karmiva 114 sivuinen raportti solidaarisuudesta! Tehty 2009-2010

Nämä löydöt kannattaa aina ladata koneelle ennenkuin ne katoavat.

Vaiettu asiakirja, täytyy lukea ajan kanssa.

Karmea taulukko jo kertoo paljon.

Toteutettavuustutkimus luoda EU-mekanismi uudelleensijoittaa
kansainvälistä suojelua tarvitsevia.
European Commission, Directorate-General Home Affairs.
Final report July 2010
http://ec.europa.eu/home-affairs/doc_centre/asylum/docs/final_report_relocation_of_refugees.pdf
Page / Sivu : 122
Numeroina edellä olevat laskelmat muuntuvat seuraavanlaisiksi kiintiöiksi:
Taulukko 17: Turvapaikanhakijoiden jakautuminen asukastiheyden painotus 200 ja eroavuustekijä 50%
Turvapaikanhakijoiden sijoitus eri
painotustekijöiden mukaan
Muutos verrattuna vuoteen 2008
Malli 1 Malli 2 Malli 3 Malli 4 Malli 1 Malli 2 Malli 3 Malli 4 Turvapaikkahakemukset
yhteensä
2008
BKT/asukas
Väestömäärä
Asukastiheys
33,3
33,3
33,3
40
40
20
60
30
10
30
60
10
33,3
33,3
33,3
40
40
20
60
30
10
30
60
10
Austria 5,253 5,678 7,331 4,662 -7,497 -7,072 -5,419 -8,088 12,750
Belgium 3,681 4,987 6,967 4,965 -7,714 -6,408 -4,428 -6,43 11,395
Bulgaria 6,450 5,590 4,885 5,004 5,705 4,845 4,14 4,259 745
Cyprus 3,103 3,736 5,734 2,689 -347 286 2,284 -761 3,450
Czech Republic 6,214 6,694 7,472 6,633 5,164 5,644 6,422 5,583 1,050
Denmark 5,890 6,715 8,901 5,767 3,515 4,34 6,526 3,392 2,375
Estonia 4,767 4,582 5,490 3,396 4,752 4,567 5,475 3,381 15

Finland 20,054 14,980 12,703 9,647 16,284 11,210 8,933 5,877 3,770
            =====
France 18,081 16,889 12,020 19,971 -23,764 -24,956 -29,825 -21,874 41,845
Germany 15,776 19,999 17,603 28,730 -5,589 -1,366 -3,762 7,365 21,365
Greece 4,586 4,232 4,525 3,410 -15,299 -15,653 -15,36 -16,475 19,885
Hungary 5,740 5,778 5,951 5,660 2,565 2,603 2,776 2,485 3,175
Ireland 7,921 8,254 10,626 6,382 4,116 4,449 6,821 2,577 3,805
Italy 8,710 11,788 10,450 17,744 -21,345 -18,267 -19,605 -12,311 30,055
Latvia 5,222 4,674 5,005 3,521 5,172 4,624 4,955 3,471 50
Lithuania 5,192 4,826 5,254 3,849 4,672 4,306 4,734 3,329 520
Luxembourg 10,419 12,52 18,743 9,447 9,964 12,065 18,288 8,992 455
Malta 2,319 2,913 4,621 2,097 -286 308 2,016 -508 2,605
Netherlands 4,982 6,647 8,649 7,143 -8,398 -6,733 -4,731 -6,237 13,380
Poland 14,073 13,615 10,713 15,831 6,868 6,41 3,508 8,626 7,205
Portugal 6,912 7,139 7,626 6,994 6,757 6,984 7,471 6,839 155
Romania 12,102 10,723 8,426 10,951 10,922 9,543 7,246 9,771 1,180
Slovakia 4,524 4,823 5,71 4,385 3,619 3,918 4,805 3,48 905
Slovenia 4,215 4,765 6,506 3,851 3,975 4,525 6,266 3,611 240
Spain 25,923 22,925 18,399 22,956 21,483 18,485 13,959 18,516 4,440
Sweden 20,469 13,747 9,965 7,447 -3,896 -10,618 -14,4 -16,918 24,365
United Kingdom 9,147 12,504 11,449 18,593 -21,398 -18,041 -19,096 -11,952 30,545
EU-27 241,73 241,73 241,73 241,73 0 0 0 0 241,725
EU-Pakolaispolitiikka 2012 http://webcache.googleusercontent.com/search?q=cache:zqebTZxRoXI...
1
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Arvoton - 16.09.2012, 20:44:14
Suomella ja Euroopalla on huutava pula väestä, jonka elämän sisältö on pirttiviljely, rukoilu, kunnia ja taistelu. Eurooppa haluaa nykyaikaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Dharma - 17.09.2012, 06:55:25
Miksi tämä asia on niin vaikea? Raja täysin kiinni ja sisään pääsee vain, jos on riittävästi varallisuutta ja/tai työ, jolla elättää itsensä ja perheensä. Loppuu kaikki ongelmat aiheeseen liittyen samana päivänä.

Argumentit humanitaarista maahanmuuttoa vastaan ovat erittäin kovat:

1. Tulijat ovat väistämättä varakkaimpia ja fiksuimpia lähtömaistaan, koska ei köyhillä ole varaa matkustaa Suomeen. Näiden vastaanottaminen heikentää lähtömaan henkistä pääomaa.
2. Tulijat tulevat rikollisjärjestöjen kautta, koska muutenhan eivät pääsisi Suomeen.
3. Yhtä vastaanotettua kohti elättäisi kymmeniä ellei satoja lähtömaassa ja rakentaisi lähtömaata.
4. Mikä on kokonaisajatus? Siirtää koko lähtömaa vähitellen länsimaahan? Jos ei, niin mikä sitten? Miksi ottaa yhtä, sataa tai tuhatta? Miksi?
5. Miksi meidän ylipäätään pitäisi uhrata itsemme muiden puolesta? Lisäksi kyseessä on joka tapauksessa mahdoton urakka.

Monikulttuurisuutta voi harrastaa työn perässä tulevien, elokuvien, kirjojen, matkustamisen, jne. kautta se ken haluaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Embo - 17.09.2012, 10:10:04
Argumentit humanitaarista maahanmuuttoa vastaan ovat erittäin kovat:

1. Tulijat ovat väistämättä varakkaimpia ja fiksuimpia lähtömaistaan, koska ei köyhillä ole varaa matkustaa Suomeen. Näiden vastaanottaminen heikentää lähtömaan henkistä pääomaa.
2. Tulijat tulevat rikollisjärjestöjen kautta, koska muutenhan eivät pääsisi Suomeen.
3. Yhtä vastaanotettua kohti elättäisi kymmeniä ellei satoja lähtömaassa ja rakentaisi lähtömaata.
4. Mikä on kokonaisajatus? Siirtää koko lähtömaa vähitellen länsimaahan? Jos ei, niin mikä sitten? Miksi ottaa yhtä, sataa tai tuhatta? Miksi?
5. Miksi meidän ylipäätään pitäisi uhrata itsemme muiden puolesta? Lisäksi kyseessä on joka tapauksessa mahdoton urakka.

6. Yhteiskunnan tasolla tarkasteltuna humanitaarinen maahanmuutto tuottaa enemmän inhimillistä pahaa kuin inhimillistä hyvää.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Nikopol - 17.09.2012, 13:28:03
Tämä on moneen kertaa todettu mutta kerta vielä: pienen väestöpohjan maissa väestönvaihto tapahtuu pienillä pääluvuilla ja paikallisesti. Prosentti lisää rikkautta koko maassa tarkoittaa 10% per isompi kaupunki, 50% per lähiökoulu, 100% per vuokratalo.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: henkka - 17.09.2012, 15:19:41
Mari on nyt hihamerkkinsä ansainnut :)

Meidän odottavien aika ollut pitkää. Parempi nyt, kun ei lainkaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: sepes - 18.09.2012, 15:21:27
Turkulainen 18.9. (http://www.turkulainen.fi/blogit/vaalikolumnit/143209-resurssit-eivat-riita-kaikkien-maahanmuuttajien-vastaanottoon)

Lainaus käyttäjältä: Maria Lohela
Resurssit eivät riitä kaikkien maahanmuuttajien vastaanottoon

Alpo Lähteenmäki (vas.) on jättänyt toimenpidealoitteen maahanmuuttajakeskittymien purkamisesta. Kyseessä on tilanne, jonka luomiseen myös Vasemmistoliitto on politiikallaan osallistunut ollessaan hallitusvastuussa tai toimiessaan Turun kaupunginhallituksessa ja - valtuustossa.
 
Tein viime vuonna eduskunnassa talousarvioaloitteen, jossa esitin määrärahoja Varissuon työllisyystilanteen kohentamiseksi kaikkien asukkaiden osalta taustasta riippumatta. Vasemmistoenemmistöinen hallitus ei katsonut esitystä tarpeelliseksi. Lähteenmäen viittaamien asiantuntijoiden mukaan 20 prosentin maahanmuuttajaosuus on raja, joilloin alueen tasapainoinen kehitys vaarantuu. Nyt maahanmuuttajaväestön osuus Varissuolla lähentelee 40 prosenttia, mutta tähän asti se on vasemmiston mukaan ollut rikkaus ja voimavara. Asumiskeskittymien ongelmat ilmeisesti havaitaan vasta nyt.
 
Ratkaisuksi Lähteenmäki ehdottaa maahanmuuttajien tarpeet huomioivien asuntojen rakentamista ympäri kaupunkia. Kaupungin vuokra-asuntoja on jo nyt hajautettu ympäri kaupunkia. Ongelma ei ole asuntojen puute tai se etteikö niitä oltaisi hajautettu, vaan humanitääristen maahanmuuttajien määrä suhteessa käytettävissä oleviin resursseihin.
 
Vasemmistolle saattaa tulla yllätyksenä, että yhteiskunnan resurssit ovat rajalliset ja vastaavat tehtyä työn määrää. Tällä hetkellä resurssit ovat vähissä. Kun ne eivät riitä vanhuspalveluihin, eivätkä nuorten syrjäytymisen ehkäisyyn, ne eivät voi riittää ulkomaalaisten asumistarpeet huomioiviin keskusta-asuntoihinkaan.
 
Hallitusohjelmassa tuetaan EU:n yhtenäisen turvapaikkajärjestelmän luomista, johon sisältyy yhteiseurooppalainen turvapaikanhakijoiden taakanjakosopimus. Tällä sopimuksella eurooppalainen toimielin on mahdollisesti siirtämässä Suomeen jopa 20 000 turvapaikanhakijaa vuosittain muista Euroopan maista. Mihin Lähteenmäki ja vasemmistoliitto ajattelivat nämä henkilöt majoittaa ja millä rahalla? Tämä edellyttäisi kahden uuden Kaarinan kokoisen kaupungin rakentamista ja ylläpitoa kaikkine palveluineen joka kolmas vuosi. Heidän sijoittamisensa Turkuun aiheuttaisi asiantuntijoiden määrittelemän tasapainoisen kehityksen rajan ylittymisen koko Turussa noin kahdessa vuodessa.
 
Humanitäärisen maahanmuuton ongelmia ei voida ratkaista vain lisäämällä resursseja, vaan vastaanottomäärä on suhteutettava käytössä oleviin resursseihin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 18.09.2012, 17:39:46
Lainaus
Kansalaisvapauksien valiokunnassa on keskiviikkona asialistalla direktiivi, joka vahvistaisi kiinniotettujen turvapaikanhakijoiden oikeuksia. Näihin oikeuksiin kuuluvat ilmainen oikeusapu, pääsy työmarkkinoille ja haavoittuvaisten henkilöiden oikeuksien huomioon ottaminen. Lisäksi pöydällä ovat asetukset, jotka määrittävät, että se maa, johon turvapaikanhakija on ensin tullut EU:n alueella, on vastuussa hakemuksen käsittelystä. Mepit saivat neuvoston kanssa aikaan sopimuksen, jossa mainitaan solidaarisuus kuormittuneita jäsenmaita kohtaan ja velvollisuus kunnioittaa turvapaikanhakijoiden perusoikeuksia.

Euroopan parlamentti (http://www.europarl.europa.eu/news/fi/headlines/content/20120913STO51331/html/T%C3%A4ll%C3%A4-viikolla-turvapaikanhakijat-%C3%B6ljy-lasten-turvallisuus-verkossa)

http://
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: kerava - 18.09.2012, 19:20:55
Mitä hallituksen budjetti lupaa 2013:

- Maahanmuuttovirtojen hallintaan ( EU ) 22 miljoonaa

- Maahanmuuttoviraston toimintamäärärahat 18 miljoonaa

- Turvapaikanhakijoiden vastaanotto 55 miljoonaa

- Kotouttaminen 95 miljoonaa

- Kielteisen turvapaikkapäätöksen saaneiden kuskaus pois 3,5 miljoonaa.

Ei ihme, että armeijalta otetaan 200 miljoonaa, nämä luvuthan menevät aika hyvin yhteen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 18.09.2012, 19:29:36
Viestisi, kerava, sopisi hyvin tähän ketjuun (http://hommaforum.org/index.php/topic,74976.0.html).
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RTT - 20.09.2012, 00:05:22
Dublin-sopimuksen muokkaaminen siten, että "ihmisarvoa loukkaavaan" EU-maahan ei enää voi palauttaa turvapaikanhakijoita, on loppusuoralla: EUobserver: EU lawmakers reinforce asylum seekers' rights (http://euobserver.com/justice/117604)

Lainaus
Authorities would also be required to interview each asylum applicant, provide a response within three months on any transfer decision, and detain only those who pose a "severe" risk of absconding. Detention would also be limited to three months.

Each asylum seeker would be entitled to appeal any transfer decision and receive free legal assistance upon request in a language they understand.

They would remain in the member state pending their transfer appeal and unaccompanied minors would have the right to reunite with relatives aside from their immediate family.

EU home affairs commissioner Cecilia Malmstrom welcomed the vote and said in a statement that it was "a big step towards a common asylum system, whereby all asylum seekers can get a fair and proper assessment of their case."
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 20.09.2012, 01:00:58
 Cecilia Malmsrtöm on maanpetturuuden lisäksi kaikkien länsimaisten arvojen tukkukauppias.

USKOMATON SVEDUPELLE.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: savipolvi - 20.09.2012, 02:56:58
Jokos virolaiset ovat heränneet tulevaan...tietääkö joku..
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Joe - 21.09.2012, 01:02:28
Virosta saamme varmasti taas suomipoikia rauhanturvajoukoiksi.

Siellä on uskomattomalla taidolla hoidettu paikalliset rantavenäläiset.

Ei se mikään turha kansa ole, nämät sukulaisemme.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.09.2012, 16:11:09
CEAS otti taas yhden merkittävän askeleen eteenpäin, kun EU-parlamentin Kansalaisvapauksien sekä oikeus- ja sisäasioiden valiokunta (LIBE) hyväksyi Dublin II -sopimuksen korvaavan sopimuspaketin.

Dublin-järjestelmää murennetaan muun muassa antamalla toista tai useampaa kertaa turvapaikkaa hakeville lupa valittaa Dublin-palautuspäätöksestä toiseen EU-maahan. Ei siis varsinaisesta turvapaikkapäätöksestä vaan siitä, että hakijan Eurodac-tietokannasta löytyneet sormenjäljet osoittavat hänen jo hakeneen turvapaikkaa toisesta EU-maasta. Oikeuden päätöstä voi odotella mieleisessään maassa, mikä varmasti tuntuu mukavalta, kun Dublin-palautus kestää byrokratioineen jo nykysäännöillä kuukausia, eikä välttämättä onnistu sittenkään. Palautuksen edelleen viivyttämiseksi myös Dublin-hakijaa olisi vastaisuudessa haastateltava (Suomessa jono haastatteluun on ollut pahimmillaan yli puoli vuotta!) ja hänelle on järjestettävä lainopillista apua.

"Alaikäiset yksinsaapuneet turvapaikanhakijat" saavat oikeuden siirtyä maahan, jossa heillä on "isovanhempia, sisaruksia, tätejä tai setiä", mikä laajentaa perheenyhdistämisiä. Mepit myös muotoilivat aiempaa väljemmin sellaisen maan määritelmän, johon käännytykset voidaan kieltää.

Lainaus
The agreement in fact introduces a series of provisions on protection of applicants, such as a compulsory personal interview, the obligation to ensure legal assistance free of charge upon request, the right to appeal against a transfer decision and the right to be informed in detail about the application of the regulation, including on effective remedy and sovereignty clause.   

Lainaus
"In an ideal world, the Dublin II regulation should not be needed. But now we are creating a new regulatory framework that provides stronger legal guarantees for individual refugees and clear rules for member states to live up to. We have agreed on the most difficult issues, such as definition of 'family', the rights of unaccompanied minors and clearer rules and time limits on locked detention for refugees. The aim is to create a humane asylum system by the end of the year", said Parliament's rapporteur Cecilia Wikström (ALDE, SE), following the Civil Liberties Committee's political endorsement.

Cecilia Malmström: Common asylum system moving closer (http://ec.europa.eu/commission_2010-2014/malmstrom/news/archives/2012/09/20120919_en.htm) 19.9.2012
European Parlament News: Asylum seekers: no transfers to EU countries unable to cope (http://www.europarl.europa.eu/news/en/pressroom/content/20120917IPR51500/html/Asylum-seekers-no-transfers-to-EU-countries-unable-to-cope) 19.9.2012
Africa News: EU moves towards new asylum system (http://www.africa-news.eu/immigration-news/italy/4674-eu-moves-towards-new-asylum-system.html) 20.9.2012

Näiden päätösten tarkoitus on lopettaa Dublin-käännytykset, lisätä turvapaikanhakijoiden määrää ja siten painostaa Keski- ja Pohjois-Euroopan maita niin, että ne myöntyvät vihdoin CEASin perusperiaatteeseen turvapaikanhakijoiden jakamisesta jäsenmaihin EU:n kautta. Maahanmuuttokomissaari riemuitsee.

Lainaus
Finally! These are two key ingredients in the final product – the common asylum system.
- Cecilia Malmström (http://blogs.ec.europa.eu/malmstrom/progress-on-common-asylum-system/)



Lyhyt artikkeli, jossa käsitellään Saksan ehdottamaa taakanjakokaavaa (ns. 'Koenigsteiner key') Puolan kannalta.
PISM: Obligatory Solidarity: Does the EU Need a Formula for Redistributing Asylum-seekers Internally? (http://www.pism.pl/publications/bulletin/no-86-419) 18.9.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: vilinpoika - 28.09.2012, 10:38:45
Pitäisi ehkä miettiä uuden pakolaisvaltion perustamista johonkin Afrikan osaan, jossa nykyisellään ei juuri asuta, yk:n johdolla. Tässä maassa ei olisi vakituisia asukkaita, muita kuin virkamiehet. Oleskeluluvat olisivat vuosi kerrallaan kaikille maahanmuuttajille. Politiikkaan osallistuminen olisi kiellettyä kaikilta, rahoitus tulisi jäsenmailta niistä varoista, jotka säästyisivät pakolaisten vastaanottamisesta. Ne käytettäisiin vesi ja wc verkkoon, parakkien rakentamiseen, järjestyksen valvontaan, infrastruktuuriin, tuotantolaitoksiin (pakolaisvaltion sisäiseen jakeluun). Poistua voisi maasta takaisin omaan maahansa milloin vain. Passi maan sisällä liikkumiseen ja elatusvelvollisuus omista lapsistaan. Tietysti yksi tehtaista olisi p-pilleritehdas, jonka tuotteita jaeltaisiin ilmaiseksi tarvitsijoille. Ehkä tämä olisi jotakin.....
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: John - 04.10.2012, 15:21:18
http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml
Päivi Räsäsen vastaus Maria Lohelan kirjalliseen kysykseen EU:n yhteisestä turvapaikkapolitiikasta:

Lainaus
Eduskunnan työjärjestyksen 27 §:ssä mainitussa tarkoituksessa Te, Herra puhemies, olette toimittanut asianomaisen ministerin vastattavaksi kansanedustaja Maria Lohelan /ps näin kuuluvan kirjallisen kysymyksen KK 671/2012 vp:

    Kannattaako hallitus EU:n yhteistä taakanjakoa turvapaikka-asioissa,

    miten hallitus on varautunut sen tarkoittamaan turvapaikanhakijamäärien merkittävään kasvuun Suomessa ja

    onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?

Vastauksena kysymykseen esitän seuraavaa:

Yhteinen eurooppalainen turvapaikkajärjestelmä on Suomen prioriteettitavoite. Esimerkiksi ennen niin sanotun Dublin-järjestelmän olemassaoloa turvapaikanhakijan oli halutessaan helppoa siirtyä jäsenvaltiosta toiseen ja saada hakemuksensa käsitellyksi useissa eri valtioissa, jos aiemmat hakuyritykset olivat johtaneet kielteiseen päätökseen. Dublin-järjestelmä ei kuitenkaan voi toimia sujuvasti sellaisten jäsenvaltioiden kesken, joiden turvapaikkajärjestelmät ovat keskenään hyvin erilaisia. Viime vuosina esimerkiksi Kreikka ei ole pystynyt turvaamaan tasoa, joka mahdollistaisi turvapaikkahakemuksen käsittelyvastuun siirtämisen Kreikalle. Tarvitaan siis paitsi yhteistä sääntelyä turvapaikkamenettelyistä, vastaanotto-oloista ja suojelun antamisen perusteista, myös tukea niille valtioille, joiden turvapaikkajärjestelmiin kohdistuu poikkeuksellinen paine. Solidaarisuus on osa yhteistä eurooppalaista turvapaikkajärjestelmää.

EU:n komissio antoi viime vuoden joulukuussa tiedonannon EU:n sisäisen solidaarisuuden lisäämisestä turvapaikka-asioissa, johon myös kansanedustajan kysymyksessä mainittu Euroopan parlamentin päätöslauselma liittyy. Komissio esitti asiakirjassaan suuren joukon erilaisia käytännön keinoja, joilla vaikeuksissa olevia turvapaikkajärjestelmiä voidaan tukea. Hallitus valmisteli tuolloin Suomen kannat komission tekemiin ehdotuksiin ja esitteli ne myös hallintovaliokunnalle.

Kuten useimmat EU:n jäsenvaltiot, myös Suomi kannattaa suurta osaa komission solidaarisuutta koskevista ehdotuksista. Erityisen keskeisenä Suomi pitää lähtökohtaa, jonka mukaan perimmäinen vastuu turvapaikkajärjestelmän toimivuudesta on kullakin jäsenvaltiolla itsellään. Käytännön solidaarisuustoimista Suomi kannattaa etenkin turvapaikkaviranomaisten yhteistyön ja Euroopan turvapaikka-asioiden tukiviraston, EASO:n, toiminnan kehittämistä. Niin ikään on erittäin tärkeää, että valmisteltavana oleva EU:n uusi maahanmuutto- ja turvapaikkarahasto sisältää riittävät varat niin erilaisia kriisitilanteita varten kuin pitkäjänteisen turvapaikkapolitiikan kehittämiseksi.

Sen sijaan Suomi ei kannata komission tiedonannossa ja myös Euroopan parlamentin päätöslauselmassa mainittua ajatusta turvapaikanhakijoiden tai kansainvälistä suojelua saavien henkilöiden siirroista EU:n sisällä. Uhkana nimittäin on, että toive siirrosta toiseen jäsenvaltioon houkuttelisi tulemaan EU:n alueelle juuri sellaisen jäsenvaltion kautta, johon maahanmuuttopainetta kohdistuu ja josta siirtoja muualle tehdään. Olisi myös varsin vaikea sopia sellaisista oikeudenmukaisista perusteista, joiden mukaan siirtyvät henkilöt ja kohdevaltiot valittaisiin.

Valtaosa jäsenvaltioista on Suomen kannalla. Kun EU:n neuvosto hyväksyi komission tiedonannon pohjalta solidaarisuutta koskevat päätelmät viime maaliskuussa, niissä korostettiin kaikkia niitä solidaarisuuden osa-alueita, joita Suomi pitää tärkeänä. Hakijoiden tai suojelua saaneiden siirtoja ei kuitenkaan haluttu edistää edes vapaaehtoisuuden pohjalta. Asiasta todettiin ainoastaan, että neuvosto tukee ajatusta tähän mennessä toteutettuja, vapaaehtoisuuteen perustuvia sisäisiä siirtoja koskevan arvioinnin tekemistä.

Komissio tai Euroopan parlamentti eivät päätä EU:n lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden kanssa. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa Suomi vaikuttaa ja on jo vaikuttanut hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

Tästä huolimatta hallitus varautuu turvapaikanhakijamäärien muutoksiin, nehän vaihtelevat paitsi eri jäsenvaltioiden välillä, myös vuosittain kansallisesti. Hallitus panostaa tehokkaaseen suomalaiseen turvapaikkajärjestelmään, joka pystyy vastaamaan niin hakijamäärän kasvuun kuin laskuunkin ja jossa päätetään siitä, kenelle suojelua Suomessa annetaan. Hallitus panostaa myös entistä yhtenäisempään eurooppalaiseen turvapaikkajärjestelmään, joka vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa.

Helsingissä 4 päivänä lokakuuta 2012
Sisäasiainministeri Päivi Räsänen

Vastauksen perusteella ei ilmeisesti ole näköpiirissä ainakaan sellaista taakanjakoa, jossa Suomeen alkaisi virrata tuhansittain lisää turvapaikanhakijoita. Roope tai joku muu asiasta enemmän tietävä osannee ehkä tulkita vastausta paremmin, vaikkakin vastaus on mielestäni vähän ympäripyöreä taas.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 04.10.2012, 16:41:17
Veli Johnia voi tässä kompata.

Näyttää siltä, ettei Suomen hallitus sentään niin hullu ole, että kannattaisi muualle EU:hun tulevien turvapaikanhakijoiden siirtämistä Suomeen. Rahaa tosin alkaa mennä tuohon solidaarisuuteen ja EASO-byrokratiaan.

Turvapaikanhakijoiden levittämistä ajavat eivät kuitenkaan lepää. Jos asiassa riittää EU:n oikeus- ja sisäministerien neuvostossa määräenemmistö, kuten täältä olin aiemmin lukevinani, niin onko pelättävissä hallituksemme joutuvan antamaan periksi jossain vaiheessa, jos riittävää määräenemmistöä ei saavuteta? Tai Räsäsen tai muun ns. oikeiston tämän punaviherenemmistöisen hallituksemme sisällä?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 04.10.2012, 23:02:27
http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml
Päivi Räsäsen vastaus Maria Lohelan kirjalliseen kysykseen EU:n yhteisestä turvapaikkapolitiikasta:

Lainaus
Komissio tai Euroopan parlamentti eivät päätä EU:n lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden kanssa. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa Suomi vaikuttaa ja on jo vaikuttanut hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

Tästä huolimatta hallitus varautuu turvapaikanhakijamäärien muutoksiin, nehän vaihtelevat paitsi eri jäsenvaltioiden välillä, myös vuosittain kansallisesti. Hallitus panostaa tehokkaaseen suomalaiseen turvapaikkajärjestelmään, joka pystyy vastaamaan niin hakijamäärän kasvuun kuin laskuunkin ja jossa päätetään siitä, kenelle suojelua Suomessa annetaan. Hallitus panostaa myös entistä yhtenäisempään eurooppalaiseen turvapaikkajärjestelmään, joka vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa.

Helsingissä 4 päivänä lokakuuta 2012
Sisäasiainministeri Päivi Räsänen

Suomi näyttäisi olevan valmis "osallistumisella ja yhteistyöllä" hyväksymään kaiken mitä ehdotetaan. Arvio perustuu siihen, ettei vastauksessa oteta kantaa kysymykseen "onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?"

Vastaus ei sulje pois mitään ratkaisuja.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 05.10.2012, 00:30:22
"onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?"

Kai ministereille on jotain sanktioita olemassa?
Räsänen ei viitsinyt/osannut/kiellettiin vastaamasta kyseiseen kirjalliseen kysymykseen!

Vastaus kiinnostaa kovasti. Uutta kysymystä kehiin! Ehkä se vastaus sieltä joskus tulee.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 05.10.2012, 10:33:46
"onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?"

Kai ministereille on jotain sanktioita olemassa?

Todennäköisesti vastauksessa ei ole juridisesti mitään "raskauttavaa". Periaatteetteessa kyseessä voi olla harhaan johtaminen, jos vastauksessa on jätetty kertomatta keskeisiä linjauksia tms.
Lainaus
Lying by omission, Wikipedia (http://en.wikipedia.org/wiki/Lie#Lying_by_omission)

Also known as a continuing misrepresentation, a lie by omission occurs when an important fact is left out in order to foster a misconception. Lying by omission includes failures to correct pre-existing misconceptions. When the seller of a car declares it has been serviced regularly but does not tell that a fault was reported at the last service, the seller lies by omission.

Mikäli poliitikko valehtelee, hän tyypillisesti muuttuu puolueelleen rasitteeksi ja hänet siirretään sivuun. Toinen "sanktion" muoto on äänestäjien mielipiteen konkretisoituminen vaaleissa.

Jos vaalien alla tulisi kertoa turvapaikkajärjestelmään kohdistuvista mahdollisista hankalista muutoksista, esitetyn kaltainen vastaus voisi hyvinkin olla tapa tehdä se. Vastauksessa ei puhuta mitään Suomen itsenäisestä päätöksenteosta ja omien etujen huomioimisesta vaan korostetaan pelkästään yhteistyötä. Miksi hallituksen linjaa ei tuoda selkeästi esiin?

Vai onko linja todellakin vastauksessa esitetty alistuva yhteistyö?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Adolf Stege - 05.10.2012, 11:02:58
Veli Johnia voi tässä kompata.

Näyttää siltä, ettei Suomen hallitus sentään niin hullu ole, että kannattaisi muualle EU:hun tulevien turvapaikanhakijoiden siirtämistä Suomeen. Rahaa tosin alkaa mennä tuohon solidaarisuuteen ja EASO-byrokratiaan.

Turvapaikanhakijoiden levittämistä ajavat eivät kuitenkaan lepää. Jos asiassa riittää EU:n oikeus- ja sisäministerien neuvostossa määräenemmistö, kuten täältä olin aiemmin lukevinani, niin onko pelättävissä hallituksemme joutuvan antamaan periksi jossain vaiheessa, jos riittävää määräenemmistöä ei saavuteta? Tai Räsäsen tai muun ns. oikeiston tämän punaviherenemmistöisen hallituksemme sisällä?

Mitä höpäjät? "Hallituksemme joutuu antamaan periksi." Ne mitään periksi anna. Suomen hallitus Pyytää emmekö saa lisää mamuja, suomeen, kun työvoimapula, ja yhteinen vastuu.

Suomen hallitus haluaa olla eu:ssa mallioppilas. Kaikki mitä sieltä tulee, niin Suomen hallitus sitä kannattaa. Esim rahoitusmarkkinavero ym
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Mansikka - 05.10.2012, 12:58:45
Kai ministereille on jotain sanktioita olemassa?
Räsänen ei viitsinyt/osannut/kiellettiin vastaamasta kyseiseen kirjalliseen kysymykseen!

On ministeriltä väärin jättää vastaamatta. Asia on merkityksellinen eikä siinä saa kaarrella. Jos meillä olisi käytössä suora demokratia, voisimme järjestää epäluottamuslauseäänestyksen eli kansanäänestyksen, jolla sisäministerin tai esimerkiksi pääministerin luottamus mitatattaisiin aidon demokraattisesti. Jo tämän mekenismin olemassaolo ohjaisi päättäjät tekemään kansan tahdon mukaista politiikkaa, muuten lähtee työt alta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 19.10.2012, 09:40:00
http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml
Päivi Räsäsen vastaus Maria Lohelan kirjalliseen kysykseen EU:n yhteisestä turvapaikkapolitiikasta:

Lainaus
Komissio tai Euroopan parlamentti eivät päätä EU:n lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden kanssa. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa Suomi vaikuttaa ja on jo vaikuttanut hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

Tästä huolimatta hallitus varautuu turvapaikanhakijamäärien muutoksiin, nehän vaihtelevat paitsi eri jäsenvaltioiden välillä, myös vuosittain kansallisesti. Hallitus panostaa tehokkaaseen suomalaiseen turvapaikkajärjestelmään, joka pystyy vastaamaan niin hakijamäärän kasvuun kuin laskuunkin ja jossa päätetään siitä, kenelle suojelua Suomessa annetaan. Hallitus panostaa myös entistä yhtenäisempään eurooppalaiseen turvapaikkajärjestelmään, joka vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa.

Helsingissä 4 päivänä lokakuuta 2012
Sisäasiainministeri Päivi Räsänen

Suomi näyttäisi olevan valmis "osallistumisella ja yhteistyöllä" hyväksymään kaiken mitä ehdotetaan. Arvio perustuu siihen, ettei vastauksessa oteta kantaa kysymykseen "onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?"

Vastaus ei sulje pois mitään ratkaisuja.

Tähän vielä palatakseni. Kalvamaan alkoi tosiaan se, minkäsuuntaisa täällä esitettiinkin, eli että Suomi ottaisi kiltisti vastaan mitä "ylhäällä" päätettäisiin. Eli mitä tämä hallitus tekisi, jos Suomen kanta esim. taakanjaon osalta häviäisi EU:n ministerineuvostossa (jossa määräenemmistö riittäisi). Nostaisi kädet pystyyn (taas), ja sanoisi ettei voi mitään kun "EU" ja "kansainvälisen sopimuksen Suomea sitova velvoite"? Tältä hallitukselta olisi varmaankin turha toivoa ainakaan mitään opt-outia Tanskan ja Britannian tyyliin. Pelkäänpä, ettei hallitukseen voi täysin luottaa,eli melkein sama kuin ei ollenkaan. Täytyy toivoa, että riittävän moni muu maa ajaisi omaa etuaan ja torppaisi tämän taakanjakohankkeen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 19.10.2012, 18:17:52
Lainaus
Päivi Räsänen: Mitä tarkoittaa EU:n yhteinen turvapaikkajärjestelmä?

EU:n yhtenäisen turvapaikkajärjestelmän tavoitteena on vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa. Turvapaikkahakemukset käsitellään pääsääntöisesti siinä maassa, johon turvapaikanhakija on EU:n alueella ensin tullut. Tavoitteen saavuttamiseksi tarvitaan yhteistä sääntelyä turvapaikkamenettelyistä, vastaanotto-oloista ja suojelun antamisen perusteista. Keskeinen väline on Eurodac-sormenjälkitiedosto, jonka avulla voidaan tunnistaa luvattomat rajanylittäjät sekä tarkistaa, onko turvapaikanhakija tehnyt jo hakemuksen toisessa EU-maassa. Tarvitaan myös tukea niille valtioille, joiden turvapaikkajärjestelmiin kohdistuu poikkeuksellinen paine. Käytännön solidaarisuustoimista Suomi kannattaa etenkin turvapaikkaviranomaisten yhteistyön ja Euroopan turvapaikka-asioiden tukiviraston, EASO:n, toiminnan kehittämistä. EU:n valmisteltavan maahanmuutto- ja turvapaikkarahaston tulee sisältää riittävät varat kriisitilanteita varten.

Sen sijaan Suomi ei kannata ajatusta turvapaikanhakijoiden tai kansainvälistä suojelua saavien henkilöiden siirroista EU:n sisällä. Perimmäinen vastuu turvapaikkajärjestelmän toimivuudesta on säilyttävä kullakin jäsenvaltiolla itsellään. Uhkana on, että toive siirrosta toiseen jäsenvaltioon houkuttelisi tulemaan EU:n alueelle juuri sellaisen jäsenvaltion kautta, johon maahanmuuttopainetta kohdistuu ja josta siirtoja muualle tehdään. Olisi myös varsin vaikea sopia sellaisista oikeudenmukaisista perusteista, joiden mukaan siirtyvät henkilöt ja kohdevaltiot valittaisiin. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä.

julkaistu kolumnina KD-lehdessä 18.10.2012.

Päivi Räsänen (http://www.paivirasanen.fi/ajankohtaista/17-blogit/545-mitae-tarkoittaa-eun-yhteinen-turvapaikkajaerjestelmae)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 23.10.2012, 13:59:00
http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml
Päivi Räsäsen vastaus Maria Lohelan kirjalliseen kysykseen EU:n yhteisestä turvapaikkapolitiikasta:
Lainaus

[...]

Yhteinen eurooppalainen turvapaikkajärjestelmä on Suomen prioriteettitavoite. Esimerkiksi ennen niin sanotun Dublin-järjestelmän olemassaoloa turvapaikanhakijan oli halutessaan helppoa siirtyä jäsenvaltiosta toiseen ja saada hakemuksensa käsitellyksi useissa eri valtioissa, jos aiemmat hakuyritykset olivat johtaneet kielteiseen päätökseen. Dublin-järjestelmä ei kuitenkaan voi toimia sujuvasti sellaisten jäsenvaltioiden kesken, joiden turvapaikkajärjestelmät ovat keskenään hyvin erilaisia. Viime vuosina esimerkiksi Kreikka ei ole pystynyt turvaamaan tasoa, joka mahdollistaisi turvapaikkahakemuksen käsittelyvastuun siirtämisen Kreikalle. Tarvitaan siis paitsi yhteistä sääntelyä turvapaikkamenettelyistä, vastaanotto-oloista ja suojelun antamisen perusteista, myös tukea niille valtioille, joiden turvapaikkajärjestelmiin kohdistuu poikkeuksellinen paine. Solidaarisuus on osa yhteistä eurooppalaista turvapaikkajärjestelmää.

EU:n komissio antoi viime vuoden joulukuussa tiedonannon EU:n sisäisen solidaarisuuden lisäämisestä turvapaikka-asioissa, johon myös kansanedustajan kysymyksessä mainittu Euroopan parlamentin päätöslauselma liittyy. Komissio esitti asiakirjassaan suuren joukon erilaisia käytännön keinoja, joilla vaikeuksissa olevia turvapaikkajärjestelmiä voidaan tukea. Hallitus valmisteli tuolloin Suomen kannat komission tekemiin ehdotuksiin ja esitteli ne myös hallintovaliokunnalle.

Kuten useimmat EU:n jäsenvaltiot, myös Suomi kannattaa suurta osaa komission solidaarisuutta koskevista ehdotuksista. Erityisen keskeisenä Suomi pitää lähtökohtaa, jonka mukaan perimmäinen vastuu turvapaikkajärjestelmän toimivuudesta on kullakin jäsenvaltiolla itsellään. Käytännön solidaarisuustoimista Suomi kannattaa etenkin turvapaikkaviranomaisten yhteistyön ja Euroopan turvapaikka-asioiden tukiviraston, EASO:n, toiminnan kehittämistä. Niin ikään on erittäin tärkeää, että valmisteltavana oleva EU:n uusi maahanmuutto- ja turvapaikkarahasto sisältää riittävät varat niin erilaisia kriisitilanteita varten kuin pitkäjänteisen turvapaikkapolitiikan kehittämiseksi.

Sen sijaan Suomi ei kannata komission tiedonannossa ja myös Euroopan parlamentin päätöslauselmassa mainittua ajatusta turvapaikanhakijoiden tai kansainvälistä suojelua saavien henkilöiden siirroista EU:n sisällä. Uhkana nimittäin on, että toive siirrosta toiseen jäsenvaltioon houkuttelisi tulemaan EU:n alueelle juuri sellaisen jäsenvaltion kautta, johon maahanmuuttopainetta kohdistuu ja josta siirtoja muualle tehdään. Olisi myös varsin vaikea sopia sellaisista oikeudenmukaisista perusteista, joiden mukaan siirtyvät henkilöt ja kohdevaltiot valittaisiin.

Valtaosa jäsenvaltioista on Suomen kannalla. Kun EU:n neuvosto hyväksyi komission tiedonannon pohjalta solidaarisuutta koskevat päätelmät viime maaliskuussa, niissä korostettiin kaikkia niitä solidaarisuuden osa-alueita, joita Suomi pitää tärkeänä. Hakijoiden tai suojelua saaneiden siirtoja ei kuitenkaan haluttu edistää edes vapaaehtoisuuden pohjalta. Asiasta todettiin ainoastaan, että neuvosto tukee ajatusta tähän mennessä toteutettuja, vapaaehtoisuuteen perustuvia sisäisiä siirtoja koskevan arvioinnin tekemistä.

Komissio tai Euroopan parlamentti eivät päätä EU:n lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden kanssa. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa Suomi vaikuttaa ja on jo vaikuttanut hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.

Tästä huolimatta hallitus varautuu turvapaikanhakijamäärien muutoksiin, nehän vaihtelevat paitsi eri jäsenvaltioiden välillä, myös vuosittain kansallisesti. Hallitus panostaa tehokkaaseen suomalaiseen turvapaikkajärjestelmään, joka pystyy vastaamaan niin hakijamäärän kasvuun kuin laskuunkin ja jossa päätetään siitä, kenelle suojelua Suomessa annetaan. Hallitus panostaa myös entistä yhtenäisempään eurooppalaiseen turvapaikkajärjestelmään, joka vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa.

Helsingissä 4 päivänä lokakuuta 2012
Sisäasiainministeri Päivi Räsänen

Ministeri Räsäsen vastaus olisi ollut pienellä hiomisella ja reippaalla lyhentämisellä paljon parempi ja uskottavampi. Olisi riittänyt, että hän olisi sanoutunut selvästi irti turvapaikanhakijoiden siirroista ja maahanmuuttopoliittisen päätösvallan luovuttamisesta ilmoittaen Suomen vastustavan niitä, tuli mikä tuli. Edelleen Räsäsen olisi ollut syytä vastustaa nykyistä kehitystä kohti EU:n yhteistä turvapaikkajärjestelmää ja sen sijaan puolustaa käytäntöjen yhtenäistämistä.

Pyrkimyksessä käytäntöjen yhtenäistämiseen olisi nimittäin hyviäkin puolia, mutta se ei suinkaan edellytä yhteistä turvapaikkajärjestelmää. Jälkimmäinen viittaa EU-puheessa paitsi käytäntöjen yhtenäistämiseen, myös niiden siirtämiseen EU-byrokratian alaisiksi. On sitä paitsi täysin mahdotonta sekä säilyttää kansallinen päätöksenteko esimerkiksi oleskelulupien myöntämisen kriteereistä, että yhtenäistää käytännöt niin pitkälle, että voidaan puhua EU:n yhteisestä turvapaikkajärjestelmästä.

Jos käytäntöjen yhtenäistäminen on Suomelle tärkeää, niin miksi Suomi ei pyri muuttamaan ulkomaalaislakejaan vastaamaan niitä direktiivejä ja Keski-Euroopan EU-maiden käytäntöjä, jotka määrittelevät EU:n nykyisen linjan? Suomi on ollut jo vuosia EU:n hövelein turvapaikanhakijoiden ja heidän omaistensa oleskelulupien jakaja, eikä ministeri ole tehnyt toistaiseksi mitään tämän muuttamiseksi. On päivänselvää, että muu Eurooppa ei tule koskaan omaksumaan Suomen käytäntöjä, joten mitä Räsänen odottaa tapahtuvan? EU:n yhteinen (keskusjohtoinen) turvapaikkajärjestelmää (CEAS) ei suinkaan johtaisi nykyisten turvapaikanhakijoiden jäämiseen Kreikkaan tai Italiaan, vaan kokonaismäärän kasvuun, joka johtaisi tulijamäärän kasvuun etenkin pohjoisessa, kun etelässä ei enää tarvitsisi pelätä karkotuksia ja palautuksia.

Räsänen kirjoittaa kuin turvapaikanhakijoiden siirtely maasta toiseen olisi jokin erityiskysymys, joka ei välttämättä sisältyisi CEASiin. Tämä on epätodennäköistä, sillä yhtenäiset käytännöt, Schengen-alueen vapaa liikkuvuus ja hiljattain sovitut Dublin-järjestelmän heikennykset johtavat jo itsessään väistämättä juuri siihen, mihin Räsänen pelkäsi turvapaikanhakijasiirtojen johtavan. Turvapaikanhakijamäärät kasvaisivat, laiton siirtolaisuus lisääntyisi ja muuttopaine heilahtaisi yhä voimakkaammin etelästä pohjoiseen. Tähän itseaiheutettuun ongelmaan annetaan EU-foorumeilla ymmärtää olevan lopulta tarjolla vain yksi pysyvä ratkaisu - "solidaarisuus ja taakanjako". Se tarkoittaa konkreettisesti turvapaikanhakijoiden siirtämistä jäsenmaasta toiseen eli kiintiöitä.

Räsäsen mukaan olisi vaikea sopia turvapaikanhakijasiirtojen oikeudenmukaisista perusteista, mutta Saksa esitti jo vuonna 1995 mallinsa, jonka mukaan kiintiöt perustuisivat valtion väkilukuun, pinta-alaan ja bkt:hen. Mallia on sittemmin rukattu erilaisissa EU-selvityksissä vieläkin "oikeudenmukaisemmaksi" (eli paremmin suurille EU-maille kelpaavaksi) siten, että Suomen kiintiö kasvaisi jonnekin 10 000 - 20 000 turvapaikanhakijan välille. Systeemin hyväksyminen varmistettaisiin luomalla EU:lle valtava pakolaisrahasto, jonka kautta kierrätettäisiin EU-rahaa turvapaikanhakijoita vastaanottaville maille.

Räsänen lienee oikeassa siinä, ettei neuvostossa ole juuri nyt tarpeeksi poliittista kannatusta turvapaikanhakijakiintiöille. Hän jättää sanomatta, että jakomallit ovat neuvottelukysymys, ja etenkin näin talouskriisin aikana köyhemmät maat voivat suostua vaikka mihin päästäkseen käsiksi pakolaisrahaston kautta jakoon tuleviin miljardeihin. Mikä on Suomen kanta siinä vaiheessa, jos suuret maat ja köyhät maat pääsevät yhteisymmärrykseen niitä itseään tarpeeksi hyödyttävästä jakomallista?

En ole kovin vakuuttunut Suomen pysyvän kielteisestä kannasta kiintiöihin ja päätöksentekovallan luovuttamiseen, niin paljon Räsänen vastauksessaan sortuu epäloogisuuksiin ja jättää olennaisia asioita kertomatta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 26.10.2012, 10:03:03
Lainaus
Improving standards for the reception of asylum seekers, Euroopan Unionin Neuvosto, 25.10.2012 (http://www.consilium.europa.eu/homepage/highlights/improving-standards-for-the-reception-of-asylum-seekers?lang=fi)

At today's meeting of the Justice and Home Affairs Council, ministers reached agreement on a directive laying down standards for the reception of asylum seekers. This directive is one of five legislative instruments making up the Common European Asylum System (CEAS) package.

The aim of the draft directive is to improve and harmonise the legal situation of applicants for international protection, regardless of the member state in which the application is made. The directive features the following innovations:

- a comprehensive set of rules governing the detention of applicants, including far-reaching guarantees for detainees
- a shorter waiting period before access to the labour market is granted
- more detailed rules on granting, limiting and withdrawing material reception conditions
- clearer rules as regards opportunities to obtain free legal assistance and representation
- more specific procedures for assessing the reception needs of vulnerable persons, such as minors and victims of torture
- additional guarantees catering for the housing needs of minor and dependent adult applicants
- entitlements in cases of serious mental disorders, including, where needed, appropriate mental health care, as well as an obligation for member states to provide requisite care for victims of torture, rape or other serious acts of violence.
     

The European Council has committed itself to establishing the CEAS by the end of 2012. Of the legislative texts making up the package (http://www.consilium.europa.eu/ueDocs/cms_Data/docs/pressData/en/jha/133162.pdf#page=3), one - the so-called qualification directive (http://www.consilium.europa.eu/uedocs/cms_data/docs/pressdata/en/jha/126305.pdf) - has already entered into force (in January 2012), following the conclusion of negotiations with the European Parliament (EP). Negotiations on the asylum procedures directive, the Dublin regulation and the Eurodac regulation are under way.

Today's agreement is based on the result of negotiations with the EP and clears the way for formal adoption.

Member states may establish more favourable rules if they so wish.


More information:

    Press release (pdf) (http://www.consilium.europa.eu/uedocs/cms_Data/docs/pressdata/en/jha/133193.pdf)
    Video coverage of the Council meeting (http://tvnewsroom.consilium.europa.eu/event/justice-and-home-affairs-council-october-2012)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 06.11.2012, 15:02:37
Lainaus
Päivi Räsänen: Mitä tarkoittaa EU:n yhteinen turvapaikkajärjestelmä?

EU:n yhtenäisen turvapaikkajärjestelmän tavoitteena on vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa. Turvapaikkahakemukset käsitellään pääsääntöisesti siinä maassa, johon turvapaikanhakija on EU:n alueella ensin tullut. Tavoitteen saavuttamiseksi tarvitaan yhteistä sääntelyä turvapaikkamenettelyistä, vastaanotto-oloista ja suojelun antamisen perusteista. Keskeinen väline on Eurodac-sormenjälkitiedosto, jonka avulla voidaan tunnistaa luvattomat rajanylittäjät sekä tarkistaa, onko turvapaikanhakija tehnyt jo hakemuksen toisessa EU-maassa.

EU-parlamentti on parhaillaan heikentämässä Dublin-järjestelmää siten, että yhä suurempi osa hakemuksista pitää käsitellä muussa kuin siinä maassa, johon turvapaikanhakija on EU:n alueella ensin tullut. Räsäsen toivoma yhteinen säätely johtaa siihen, että vaatimusten tarkentuessa ja kasvaessa niiden maiden ei tarvitse ottaa vastaan Dublin-palautettavia turvapaikanhakijoita, jotka eivät yllä vastaanottojärjestelmässään yhteisten standardien tasolle. On vaikea nähdä, että esimerkiksi Kreikka pystyisi tai Italia haluaisi tätä tasoa saavuttaa kymmenessäkään vuodessa. Mikä siis olisi Räsäsen tavoitteleman EU:n yhteisen turvapaikkajärjestelmän toimintaperiaate tätä odotellessa?

Lainaus käyttäjältä: Päivi Räsänen
Tarvitaan myös tukea niille valtioille, joiden turvapaikkajärjestelmiin kohdistuu poikkeuksellinen paine. Käytännön solidaarisuustoimista Suomi kannattaa etenkin turvapaikkaviranomaisten yhteistyön ja Euroopan turvapaikka-asioiden tukiviraston, EASO:n, toiminnan kehittämistä. EU:n valmisteltavan maahanmuutto- ja turvapaikkarahaston tulee sisältää riittävät varat kriisitilanteita varten.

Maahanmuutto- ja turvapaikkarahaston varoja ollaan lisäämässä, mutta ei niinkään kriisitilanteiden varalle kuin jatkuvaksi tulovirraksi etelän turvapaikkainfrastruktuurin kehittämiseksi. Rahastojen kautta on myös tarkoitus rahoittaa EU:n kiintiöpakolaisten vastaanoton lisääminen. Tämä hanke on tosin onneksi toistaiseksi seisahtunut.

Lainaus käyttäjältä: Päivi Räsänen
Sen sijaan Suomi ei kannata ajatusta turvapaikanhakijoiden tai kansainvälistä suojelua saavien henkilöiden siirroista EU:n sisällä. Perimmäinen vastuu turvapaikkajärjestelmän toimivuudesta on säilyttävä kullakin jäsenvaltiolla itsellään. Uhkana on, että toive siirrosta toiseen jäsenvaltioon houkuttelisi tulemaan EU:n alueelle juuri sellaisen jäsenvaltion kautta, johon maahanmuuttopainetta kohdistuu ja josta siirtoja muualle tehdään. Olisi myös varsin vaikea sopia sellaisista oikeudenmukaisista perusteista, joiden mukaan siirtyvät henkilöt ja kohdevaltiot valittaisiin. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä.

Turvapaikanhakijoiden jakamisesta pitää irtisanoutua etukäteen ja näkyvästi. Pelkkä vakuutus neuvoston kannatuksen puutteesta ei ole riittävä tae, kun hanke kuitenkin etenee koko ajan parlamentissa. Etenkin kun päätökset tehdään nykyään enemmistöperiaatteella, jolloin Suomi voi yhtäkkiä löytää itsensä vähemmistöstä, jos siirtoperiaatteet ("distribution key") hiotaan Etelä-Euroopan maiden, suurten maiden ja Itä-Euroopan köyhien maiden enemmistölle mieleisiksi.

Tämä muistuttaa aivan liian paljon talouskriisin aikana annettuja vakuutuksia, kuinka tiettyä toimenpidettä ei missään tapauksessa tulla hyväksymään, koska sille ei ole neuvostossa kannatustakaan. Sitten on käännetty takki vedoten solidaarisuuteen, yhteiseen hyvään ja vaihtoehtojen puutteeseen. Aivan samoin EU on tarkoituksella maalaamassa itseään nurkkaan EU:n yhteisellä turvapaikkajärjestelmällä ja Dublin-järjestelmän murentamisella niin, että ainoaksi ratkaisuksi valikoituu loppupeleissä kuin itsestään turvapaikanhakijoiden siirrot EU-maasta toiseen.

Lainaus
Parliament calls on the Commission to include an "EU distribution key" for relocating beneficiaries of international protection in its future legislative proposal for a permanent intra-EU relocation mechanism. The system would take account of beneficiaries' best interests and integration prospects and objective indicators for member states, such as GDP, population and surface area.

A "distribution key" could help EU countries facing disproportionate pressures on their national asylum systems or in emergency situations, say MEPs, who also call on the Commission to study the feasibility of introducing a system for also relocating asylum seekers.
European parliament: Asylum policy: MEPs call for fair shares and solidarity (http://www.europarl.europa.eu/news/en/pressroom/content/20120907IPR50814/html/Asylum-policy-MEPs-call-for-fair-shares-and-solidarity) 11.9.2012

On huolestuttavaa, että Räsänen ei edes näön vuoksi vastusta hakemusten käsittelyn keskittämistä. Sehän edellyttäisi samoja standardeja turvapaikan myöntämiseen kaikissa maissa, mikä taas tarkoittaa omasta turvapaikkapolitiikasta luopumista. On ratkaiseva periaatteellinen ero, pyritäänkö eri maitten järjestelmien yhtenäisyyteen ja kansallisten päätösvallan säilyttämiseen vai yhteiseen EU-tason järjestelmään ja kansallisesta päätösvallasta luopumiseen.

Lainaus käyttäjältä: European parliament
Joint processing system

Processing asylum applications jointly would enable member states to support each other at various stages of the asylum application processing procedure, such as identifying applicants, preparing first-instance decisions, conducting interviews or making recommendations. Parliament welcomes the study launched by the Commission to investigate the legal and practical implications of a joint processing system in the EU.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 06.11.2012, 15:21:10
...

Turvapaikanhakijoiden jakamisesta pitää irtisanoutua etukäteen ja näkyvästi. Pelkkä vakuutus neuvoston kannatuksen puutteesta ei ole riittävä tae, kun hanke kuitenkin etenee koko ajan parlamentissa. Etenkin kun päätökset tehdään nykyään enemmistöperiaatteella, jolloin Suomi voi yhtäkkiä löytää itsensä vähemmistöstä, jos siirtoperiaatteet ("distribution key") hiotaan Etelä-Euroopan maiden, suurten maiden ja Itä-Euroopan köyhien maiden enemmistölle mieleisiksi.

Tämä muistuttaa aivan liian paljon talouskriisin aikana annettuja vakuutuksia, kuinka tiettyä toimenpidettä ei missään tapauksessa tulla hyväksymään, koska sille ei ole neuvostossa kannatustakaan. Sitten on käännetty takki vedoten solidaarisuuteen, yhteiseen hyvään ja vaihtoehtojen puutteeseen. Aivan samoin EU on tarkoituksella maalaamassa itseään nurkkaan EU:n yhteisellä turvapaikkajärjestelmällä ja Dublin-järjestelmän murentamisella niin, että ainoaksi ratkaisuksi valikoituu loppupeleissä kuin itsestään turvapaikanhakijoiden siirrot EU-maasta toiseen.
...

On huolestuttavaa, että Räsänen ei edes näön vuoksi vastusta hakemusten käsittelyn keskittämistä. Sehän edellyttäisi samoja standardeja turvapaikan myöntämiseen kaikissa maissa, mikä taas tarkoittaa omasta turvapaikkapolitiikasta luopumista. On ratkaiseva periaatteellinen ero, pyritäänkö eri maitten järjestelmien yhtenäisyyteen ja kansallisten päätösvallan säilyttämiseen vai yhteiseen EU-tason järjestelmään ja kansallisesta päätösvallasta luopumiseen.
...

MITEN NÄMÄ ASIAT SAADAAN KANSALAISTEN TIETOUTEEN JA YLEISEEN KESKUSTELUUN?

Mitään hyötyä tästä asioiden oivaltamisesta ei ole, jos nämä hyvät ja kansantajuiset kommentit hautautuvat Hommaforumille ja me täällä keskenämme nyökyttelemme, että näinhän tämä on...

Halla-aholaisten ja muidenkin ps-kansanedustajien PITÄÄ OTTAA NYT VIHDOIN TEHTÄVÄKSEEN MAAHANMUUTTOPOLITIIKAN AUKISELITTÄMINEN KANTISTAVIKSILLE!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 08.11.2012, 17:21:52
Olisikohan tässä ketjussa jo Lohelalle, Mestarille tai muulle tolkun PS-kansanedustajalle koossa jatkokysymyksen aineksia eduskuntaan?

Vaadittaisiin vastaamaan kyllä tai ei sarjaan mahdollisimman tarkoin ja yksiselitteisiksi mietittyihin kysymyksiin koskien edellä kuvattuja tilanteita, mukaan lukien Suomen Opt-out siinä tilanteessa, että muu EU pääsisi sopuun.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.11.2012, 17:54:32
Lainaus
Muualta tulleiden määrä kasvaa pääosin työpaikan, opiskelun ja perhesiteiden vuoksi, mutta myös turvapaikkaa hakevien ja kiintiöpakolaisten myötä. Suomi kuuluu maailmassa ja myös Euroopassa harvoihin maihin, jotka ottavat vastaan kiintiöpakolaisia, hallitusohjelmassa sovitusti 750 vuosittain. Maahanmuuttajien kotouttamisen tasoon ei voi olla tyytyväinen, siitä kertoo kolminkertainen työttömyysriski kantaväestöön verrattuna.

Viranomaisten ja oikeuslaitoksen tulee kohdella turvapaikan hakijoita yksilöllisesti, lakien ja kansainvälisten sopimusten mukaisesti. Tämän syksyn aikana pyritään samaan päätökset EU:n yhteisestä turvapaikkajärjestelmästä. Sillä tavoitellaan yhtenäisiä menettelyjä ja vastaanotto-olosuhteita koko EU:n alueella. Myös painetta siirtyä maasta toiseen paremman suojelun toivossa vähennetään.

On syytä myös Suomessa arvioida jatkuvasti sitä, tukeeko kansallinen lainsäädäntömme niin yksilöiden kuin koko yhteiskuntamme kannalta inhimillistä ja kestävää maahanmuuttopolitiikkaa.
Päivi Räsänen: Muukalaisena Suomessa (http://paivirasanen.puheenvuoro.uusisuomi.fi/123895-muukalaisena-suomessa) 8.11.2012

Jos pyrimme saamaan päätökset EU:n yhteisestä turvapaikkapolitiikasta, jolla tavoitellaan yhtenäisiä menettelyjä ja vastaanotto-olosuhteita koko EU:n alueella, on kansallisessa lainsäädännössä enää vain vähän jos lainkaan liikkumavaraa maan kansalliselle turvapaikkapolitiikalle. Jäljelle jää lähinnä ns. kotouttamispolitiikka, jonka toimivuus lisääntyvän maahanmuuton ongelmien ratkomisessa on jo osoittanut rajallisuutensa ympäri Eurooppaa.

Lainaus
EU:s förhandlingar om en gemensamt asyl- och migrationspaket i de olika länderna är inne i sin slutfas och Europaparlamentet och EU:s ministerråd ska snart fatta ett beslut om asylpaketet.

Förhoppningen är att ett lagstiftningspaket ska leda till att asylsansökningar ska bedömas på samma sätt i alla EU-länder.
Arbetet: Asylpaket för EU på väg (http://arbetet.se/2012/11/08/asylpaket-for-eu-pa-vag/) 8.11.2012

Pian valmistuva turvapaikkapaketti ei vielä johda "turvapaikkahakemusten samanlaiseen käsittelyyn kaikissa EU-maissa". Paketista sopiminen olisi ollut täysin mahdotonta, jos yhteisistä kriteereistä olisi pitänyt päästä yksimielisyyteen, sillä niin paljon eri maiden oleskelulupakriteerit poikkeavat toisistaan.

Kysymys kuuluukin, kenen ehdoilla tällaisista yhteisistä säännöistä ylipäätään sovittaisiin, ja tarkoittaisiko se samalla jäähyväisiä kansalliselle päätöksenteolle. Suomen ei kannata pysyvästi hirttäytyä kaikille yhteisiin kriteereihin, mutta Suomen kriteerejä voitaisiin toki muuttaa lähemmäksi muiden EU-maiden keskimääräisiä kriteerejä. Tällainen käytäntöjen yhtenäistäminen olisi milloin tahansa mahdollista, eikä siihen tarvita EU:n yhteistä turvapaikkajärjestelmää. Suomi on viime vuosina myöntänyt turvapaikanhakijoille oleskelulupia helpommin kuin mikään muu EU-maa.

Lainaus käyttäjältä: Arbetet
– Sverige hade en beviljningsgrad kring 70 procent av dessa ansökningar medan Greklands låg mellan 0 och 1 procent, sa han.

Migrationsministern sa också att förhandlingarna om ett asylpaket var en viktig fråga för svensk del.

– I dag har vi en situation där 9 av EU:s 27 länder tar emot 90 procent av alla asylansökningar. Sverige är en av de länder som tar emot flest, sa han och efterlyste att flera länder skulle ta emot flera flyktingar.

Ruotsin tapauksessa voi kerrankin sanoa, että niin makaa kuin petaa. Ruotsi on ihan itse ampunut itseään jalkaan liberaalilla turvapaikkapolitiikallaan. Muilla mailla ei ole mitään tarvetta ottaa vastaan enemmän pakolaisia. Ruotsi voi halutessaan milloin tahansa tehdä lakeihinsa turvapaikkamaahanmuuttoa vähentäviä muutoksia, mutta maan hallitus on tarkoituksella valinnut toisin (http://hommaforum.org/index.php/topic,77138.msg1161786.html#msg1161786).

Lainaus käyttäjältä: Arbetet
Enligt Tobias Billström är frågan om en gemensam asylpolitik kopplad till EU:s fria rörlighet. En förutsättning för att ha öppna gränser i unionen är att EU har en stark gemensam yttre gräns.

Just nu diskuterar EU förändringar i det så kallade mottagardirektivet och Dublinförordningen. ?Mottagardirektivet handlar om procedurer för hur asylsökande ska tas emot medan Dublinförordningen är en av EU:s mest omstridda förordningar som reglerar vilken medlemsstat det är som ska handlägga en ansökan om asyl.

Grundprincipen är att asyl ska sökas i det EU-land dit den asylsökande kom först. Det som diskuteras nu är möjligheten att göra avsteg från den principen. Enligt Cecilia Malmström är förhandlingen om Dublinförordningen snart färdiga. EU-kommissionens förhoppning är att de ska vara klara innan årets slut.

Eli Dublin-järjestelmän periaatetta ensimmäisen EU-maan vastuusta käsitellä turvapaikanhakijan hakemus tullaan heikentämään. Sehän ei suinkaan tarkoita, kuten ministeri Räsänen uudistuksilta toivoo, että "painetta siirtyä maasta toiseen paremman suojelun toivossa vähennetään", vaan paine lisääntyy entisestään, kun laittomien siirtolaisten riski joutua ei-toivotussa maassa viranomaisten käsiin ja palautetuksi tai käännytetyksi vähenee. Mielestäni tämä paineen lisääminen on osa komissaari Malmströmin ja kumppanien suunnitelmaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 08.11.2012, 19:49:51
Hallituksen salattu EU-politiikka

Nykyisen hallituksen tapa salailla EU-politiikkaa johtaa huonoihin päätöksiin. Koska päätettävät asiat taustatietoineen pidetään salaisina, vaikutusten ja vaihtoehtojen arviointi julkisessa keskustelussa on mahdotonta.

Salaaminen palvelee valtaa käyttävien motiiveja sekä talous- että maahanmuuttopolitiikassa. Hallituksen toiminta EU-politiikan osalta ei edusta avoimen ja demokraattisen yhteiskunnan periaatteita.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Atte Suomalainen - 08.11.2012, 20:30:29

 Hallitus panostaa myös entistä yhtenäisempään eurooppalaiseen turvapaikkajärjestelmään, joka vähentää turvapaikanhakijoiden tarvetta liikkua jäsenvaltiosta toiseen paremman suojelun toivossa.[/i]
[/quote]
Mitähän tuo parempi suojelu pitää sisällään? Eikö pelkkä suojelu riitäkään?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.11.2012, 14:55:18
Lainaus
EU:n yhteinen turvapaikkapolitiikka kohta valmis

EU on pian saamassa yhteisen ohjelman turvapaikka- ja maahanmuuttopolitiikkaan. Nykyään yhdeksän EU-maata ottaa vastaan melkein 90 prosenttia kaikista pakolaisista, ja tapausten käsittely vaihtelee suuresti maasta toiseen. Uuden lainsäädännön tavoitteena on, että kaikkia pakolaiset saavat saman kohtelun ja päätökset saapumismaasta riippumatta, ja että vastuu jakautuu tasaisemmin.

- Ilman päätösten yhtenäistämistä maiden välinen epäluulo kasvaa.

[...]

Uutta lainsäädäntöä on valmisteltu kymmenen vuoden ajan, mutta nyt se on loppusuoralla. Eräät yhteiset minimisäädökset ovat jo voimassa. Niissä määritellään, kuinka maan on käsiteltävä turvapaikanhakijaa, kuinka turvapaikkaprosessi etenee ja mitä oikeuksia turvapaikanhakijalla on päätöstä odottaessaan. Mutta erot ovat edelleen suuria, ja nyt sääntöjä harmonisoidaan entisestään uudessa pakolaislainsäädännössä, joka määrittää yhteiset turvapaikkasäännöt koko EU:lle, ja jonka europarlamentti ja EU:n ministerineuvosto pian hyväksyvät.

Yksi lainsäädännön tavoitteista on jakaa vastaanottovastuu EU-maiden kesken tasaisemmin.

[...]

- Nykyään 9-10 maata ottaa vastaan melkein kaikki EU:hun saapuvat turvapaikanhakijat, mikä tarkoittaa, että 17 maata voisi tehdä paljon enemmän. Jos niillä kaikilla olisi tarvittava infrastruktuuri, osaava henkilökunta ja mahdollisuus vastaanottoon, hakeutuisivat ihmiset enemmän myös muihin maihin, sanoo Cecilia Malmström.

[...]

Ruotsin ei tarvitse tehdä vähemmän, mutta muiden on ehdottomasti tehtävä enemmän, sanoo maahanmuuttoministeri Tobias Billström.

Toiveena on, että uusi lakipaketti johtaisi siihen, että turvapaikkahakemukset käsiteltäisiin samalla tavalla kaikissa EU-maissa. Komissaari Cecilia Malmströmin mukaan on turvapaikanhakijoiden vastaanottojärjestelmä melkein romahtanut monissa maissa, etenkin Etelä-Euroopassa, kuten Kreikassa.  (käännös)
Sveriges Radio: Gemensam asylpolitik inom EU snart på plats (http://sverigesradio.se/sida/artikel.aspx?programid=3993&artikel=5341339) 10.11.2012

Päätöntä tekstiä.

Suomen ja Ruotsin turvapaikkakäytännöt ovat suunnilleen samalla tasolla, joten yhteiset säännöt eivät vaikuta niin, että Suomeen tulisi Ruotsista enemmän turvapaikanhakijoita. Kuitenkin Suomi on komissaari Malmströmin kielenkäytössä niitä maita, jotka "voisivat tehdä paljon enemmän", joskus jopa nimeltä mainiten.

Uutisessa annetaan ymmärtää, että lakipaketin hyväksymisen jälkeen turvapaikkahakemukset arvioitaisiin kaikissa maissa samoilla kriteereillä, jolloin maiden väliset erot katoaisivat. Turvapaikanhakijat saisivat saman kohtelun kaikissa maissa, eikä heidän tarvitsisi enää turvapaikkashoppailla. Näinhän ei tule tapahtumaan. Vain itse käsittelyprosesseja yhtenäistetään.

On kuvaavaa, että Ruotsin maahanmuuttoministeri Tobias Billström esittää, että Ruotsin ei suinkaan tarvitse "tehdä vähemmän" (eli tiukentaa omaa politiikkaansa), vaan kaikkien muiden pitää "tehdä enemmän". On täysin epärealistista odottaa, että muut maat nostaisivat standardinsa Ruotsin ja Suomen tasolle. Tämä osoittaa, etteivät poliitikot itsekään usko omiin puheisiinsa "vastuun tasaisemmasta jakautumisesta". Maiden väliset suuret erot turvapaikanhakijoiden määrässä tulevat pysymään suunnilleen samanlaisina lakipaketin jälkeenkin, elleivät jopa suurene, kun tieto Dublin-järjestelmän heikennyksistä leviää. Mutta näitä eroja voi taas käyttää hivutuksen seuraavaan vaiheeseen, joka on hakemusten käsittelyn keskittäminen, ja seuraavaan, joka on turvapaikanhakijakiintiöt.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.11.2012, 18:13:59
Lainaus
Abstract

Faced with persistent Member State concerns regarding the often volatile and highly uneven distribution
of asylum applications across the European Union, and with some of the ongoing challenges facing the
operation of the Common European Asylum System (CEAS) visibly highlighted by recent migratory flows
to the EU as a side effect of the Arab Spring, the European Commission issued a communication in December
2011 “on enhanced intra-EU solidarity in the field of asylum” that seeks to create “an EU agenda for better
responsibility sharing and more mutual trust”. In this communication, the Commission proposes that the
strengthening of so-called responsibility sharing (which refers to the need to share the responsibility for and
the costs associated with the protection of refugees among receiving countries) should be reinforced around
four axes: practical cooperation and technical assistance, financial solidarity, allocation of responsibilities,
and the improvement of tools for governance of the asylum system. The Commission also advocates for an
increase in the use of internal relocation of asylum applicants among Member States and for the possibility
of a move towards the joint processing of asylum applications in EU territory. While the focus on solidarity
as an essential component of the CEAS is not new, the renewed impetus to improve the system and to ensure
that those states that are facing higher levels of responsibility are able to uphold their commitments under
both EU and international law has become necessary as a result of the lack of progress made in recent years.

This paper will analyze this most recent articulation of the Commission’s plan for enhancing solidarity and
will show that even though many of the recommendations made by the Commission should be encouraged,
they fail to address the structural, institutional features of the system ? namely the distribution key for
financial responsibility sharing and the responsibility allocation principle underlying physical responsibility
sharing
? which are perpetuating these inequalities.
SIEPS: Evaluating the Prospects for Enhanced Solidarity in the Common European Asylum System (2012:15epa) (http://www.sieps.se/sites/default/files/2012_15epa_1.pdf) (pdf)

Paperissa päädytään ilmeiseen lopputulokseen. Komission puheet "solidaarisuudesta ja taakanjaosta" eivät nykyisillä keinoilla johda siihen, millä EU:n yhteistä turvapaikkajärjestelmää (CEAS) kaupataan, eli turvapaikanhakijoiden tasaisempaan jakautumiseen eri EU-maiden kesken. Ei ilman turvapaikanhakijoiden pakkosiirtoja, jäsenmaiden merkittävää taloudellista tukea ja Dublin-järjestelmän periaatteista luopumista.

Lainaus
The 2011 Communication consequently does not consider it appropriate at this time to introduce any specific
proposal or mechanism for internal relocation. Instead, it encourages the continuation and further use of vol-
untary schemes, such as the one operating in Malta, and has accordingly allocated resources in the AMF
proposal for such activities and have given EASO the mandate to facilitate these activities. Beyond the im-
plications listed above, however, a purely voluntary arrangement of internal relocation is most unlikely to be
sufficient enough “corrective” responsibility sharing mechanism to supplement the effects of an unchanged
Dublin system and to adequately lighten the “burden” of overstretched Member States. And while the EURE-
MA project seems to have enjoyed moderate success (though on a small scale), it might not be unreasonable
to expect that the operation of a purely voluntary system might run the risk of inevitable “pledging fatigue”.

[...]

The current system actually represents a significant departure from the original sharing system proposed by
the German Presidency in 1994, which asserted that the distribution of refugees should be based on various in-
dicative measures that would result in a quota system. The proposed criteria for distribution amongst Member
States, all of which were to be given equal weight, included: the size of the population as a proportion of the
whole Union; the size of the national territory as a proportion of the whole Union; and GDP as a proportion
of the whole Union. The draft proposal also allowed for consideration of alternative methods of contribution, in
that the system would allow for shortfalls by any country that was contributing significantly to foreign and
security policy efforts through peace-making or peacekeeping efforts, by ensuring that less involved countries
would compensate for this shortfall by higher levels of contributions themselves. This proposal, however, did
not receive the support of other key Member States, and as shown above, similar recommendations and propos-
als for systems involving quotas according to proportional distribution keys have remained controversial.
Thus, we are faced with a stalemate when it comes to advancing this policy area.

Ultimately, there remains an urgent need to improve the system for responsibility sharing in the EU. Al-
though significant developments have been made in recent years, the current operating state of the CEAS
is not sufficient to adequately ensure a fairer distribution of asylum costs and responsibilities or to ensure a
consistent standard of protection across the EU. While many of the recommendations made by the Commis-
sion in the 2011 Communication should be encouraged, this paper has demonstrated that those proposed
action points are unlikely to be sufficient due to several crucial deficiencies. The 2011 Communication
fails to reconsider the distribution key for financial responsibility sharing. It fails to sufficiently acknowl-
edge the importance of relative “burdens” and relative capacity in the operation of the Dublin system. It also
fails to consider more seriously binding (rather than merely voluntary) mechanisms for internal relocation.
Thus, in the light of some of these shortcomings, this latest push by the Commission to improve intra-EU
solidarity fails to adequately address the structural and institutional features of the system that are perpetuat-
ing existing inequalities and is therefore unlikely to produce the improvements required by the current
system. Ultimately, improved solidarity is contingent on an improved system of responsibility sharing; how-
ever, the achievement of an improved system of responsibility sharing is equally, if not more, contingent
on already existing solidarity. It would seem that this is where the problem lies.

Kukaan tietämäni tutkija tai muu kommentoija ei muutamia harvoja poliitikkoja (mm. Päivi Räsänen, Tobias Billström ja Cecilia Malmström) lukuun ottamatta ole väittänyt, että turvapaikanhakijat jakautuisivat tasaisesti edes EU:n yhteisessä turvapaikkajärjestelmässä muuten kuin pakkosiirroilla. Jos CEASin perimmäinen tarkoitus on turvapaikanhakijoiden tasainen jakaminen "solidaarisuuden ja taakanjaon" nimissä, on sen perimmäisenä ytimenä, lopullisena keinona tuon tavoitteen saavuttamiseksi, oltava ennen pitkää turvapaikanhakijoiden jakaminen joko kiintiöillä ja/tai erityisesti Suomelle kalliiksi käyviä taloudellisia houkuttimia (http://econ.sciences-po.fr/sites/default/files/file/Hillel%20Rapoport.pdf) käyttäen. Tätä edeltää turvapaikkapoliittisen päätösvallan siirtäminen harmonisoinnin varjolla pala palalta EU-elimille.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 11.11.2012, 21:02:23
Ennen kuin Suomi sitoo itsensä EU:n yhteiseen turvapaikkajärjestelmään sen vaikutukset tulee arvioida julkisesti. Erityisen tärkeänä näen Suomen edeskunnan valta-aseman muutoksen, luopuuko Suomi keskeisestä osasta itsenäisyyttään?

Onko nyt välikysymyksen aika? Jälkeenpäin on turha itkeä.

Lainaus
Suomen perustuslaki - Välikysymys (http://www.finlex.fi/fi/laki/ajantasa/1999/19990731)

 43 §
Välikysymys

Vähintään kaksikymmentä kansanedustajaa voi tehdä valtioneuvostolle tai ministerille näiden toimialaan kuuluvasta asiasta välikysymyksen. Välikysymykseen tulee vastata eduskunnan täysistunnossa viidentoista päivän kuluessa siitä, kun kysymys on saatettu valtioneuvoston tietoon.

Välikysymyksen käsittelyn päätteeksi toimitetaan äänestys valtioneuvoston tai ministerin nauttimasta luottamuksesta, jos keskustelun aikana on tehty ehdotus epäluottamuslauseen antamisesta valtioneuvostolle tai ministerille.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Sampo Terho - 18.11.2012, 09:46:31
Tervehdys, asia ei välttämättä tämän ketjun lukijoille ole uutta, mutta alla silti linkki uusimpaan blogiini EU:n yhteisestä turvapaikkapolitiikasta.
http://www.sampoterho.net/?p=2208 (http://www.sampoterho.net/?p=2208)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.11.2012, 13:52:42
Tervehdys, asia ei välttämättä tämän ketjun lukijoille ole uutta, mutta alla silti linkki uusimpaan blogiini EU:n yhteisestä turvapaikkapolitiikasta.
http://www.sampoterho.net/?p=2208 (http://www.sampoterho.net/?p=2208)

Lainaus käyttäjältä: Sampo Terho
Erityisesti monia mietityttää, ryhtyykö EU päättämään jäsenmaiden vastaanottaman humanitaarisen maahanmuuton määrästä? Kysymykseen ei aitoon EU:n tapaan ole yksiselitteistä vastausta.

Napakka yhteenveto monimutkaisesta aiheesta, jonka herättämiin kysymyksiin on tosiaan vaikea löytää yksiselitteisiä vastauksia. Kaiken voi kiistää, koska keskustelu, dokumentit ja päätöksenteko ovat niin hajanaisia ja epämääräisiä.

Kirjoituksessa mainitun solidaarisuuden ohella toinen taajaan toistettu avainkäsite on tässä yhteydessä taakanjako ("burden sharing"). Sen voi toki tulkita pelkäksi taloudelliseksi taakanjaoksi, mutta jo Saksan EU-puheenjohtajakaudella vuonna 1994 kirjoitettiin päätösluonnos (http://http//hommaforum.org/index.php/topic,27433.msg580296.html#msg580296) turvapaikanhakijoiden jakamisen kriteereistä ("distribution key": väkiluku, pinta-ala, bkt). Tämä siis vuosia ennen vuoden 1999 Tampereen sopimusta (http://www.europarl.europa.eu/summits/tam_en.htm), jota pidetään lähtölaukauksena EU:n yhteiselle turvapaikkajärjestelmälle (CEAS). Vuoden 1994 jakokriteerit ovat eläneet suunnilleen samassa muodossa parlamentin keskusteluissa ja päätöksissä tähän päivään ja europarlamentin lokakuiseen mietintöön saakka.

Turvapaikanhakijoiden siirrot ovat ainoa realistinen keino päästä CEASille asetettuun tavoitteeseen jakaa turvapaikanhakijat jäsenmaiden kesken "oikeudenmukaisesti". Taloudellinen tuki ei sitä tee, yhtenäiset turvapaikkakäytännöt eivät sitä tee, eikä edes hakemusten yhteiskäsittely sitä tee. EU on teettänyt monta selvitystä turvapaikanhakijoiden uudelleenjakamisen perusteista, mutta yksikään paperi ei käsittele CEASin aiottujen toteutusvaihtoehtojen seurauksia jäsenmaiden ja koko EU:n näkökulmasta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 19.11.2012, 23:14:35
Kreikan natsien harjoittamaa väkivaltaa maassa olevia humanitaarisia maahanmuuttajia kohtaa koskevista uutisista juolahti mieleen uhkakuva, jossa saisimme joululahjaksi CEASin taakanjaon ja turvapaikanhakijoiden uudelleensijoittelun. Asian nouseminen uutisiin pohjustaisi kenties maaperää. Uskoisin joidenkin maiden (ja tetysti entisen Ruotsin komissaarin) haluavan luoda EU:n ministerineuvostolle paineita tähän suuntaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: orientexpressen - 20.11.2012, 16:34:47
Ruotsin radion mukaan 25 EU-maata (yhteensä 27:stä) on ilmoittanut olevansa täysin taakanjakoa vastaan. Vastustaviin maihin kuuluu myös Ruotsi. Syyksi sanotaan se, että maat haluavat pitää turvapaikkapolitiikan päätösvallan itsellään.

Komissaari Cecilia Malmström valittelee tilannetta, siinä missä Ruotsin maahanmuuttoministeri Tobias Billström sanoo olevansa sitä mieltä, että ehdotettu taakanjakomekanismi loisi turhia jännitteitä EU-maiden välille ja että tarvitaan kehittyneempiä ratkaisuja.

Taakanjako voisi vähentää Ruotsin turvapaikanhakijamääriä 30-64 prosentilla, tai enimmillään 28.000 henkilöllä.

http://sverigesradio.se/sida/artikel.aspx?programid=83&artikel=5351762
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 20.11.2012, 18:26:33
http://sverigesradio.se/sida/artikel.aspx?programid=83&artikel=5351762

Lainaus
Turvapaikanhakijoiden epätasaisen jaon muuttaminen vaikeaa

Ruotsin turvapaikanhakijoiden määrä voitaisiin puolittaa jakamalla pakolaiset tasaisemmin EU:n sisällä. Europarlamentti ajaa asiaa, mutta Ruotsin hallitus suhtautuu ehdotukseen epäillen.

Nykyään turvapaikanhakijoiden jakautuminen EU:ssa on äärimmäisen epätasaista. Yhdeksän EU-maata ottaa vastaan yli 90 prosenttia kaikista pakolaisista.

Ruotsi on kärkipaikoilla. Ruotsi on neljännellä sijalla Ranskan, Saksan ja Italian jälkeen. Suuri osa maita, etenkin Itä- ja Keski-Euroopassa, ei ota pakolaisia vastaan juuri lainkaan.

Europarlamentti haluaakin nyt tasoittaa erot EU-maiden talouteen ja väkilukuun perustuvilla kiintiökaavoilla.

Europarlamentissa asiaa käsittelevä kyproslainen Kyriacos Triantaphyllides sanoo, että ettei edes niin rikas maa kuin Ruotsi ehkä pysty sulattamaan näin suurta määrää pakolaisia. Silloin muiden EU-maiden tultava avuksi.

- Voi tulla ajankohtaiseksi siirtää pakolaisia toisiin EU-maihin, jotka eivät ole yhtä heikossa asemassa, sanoo Kyriacos Triantaphyllides.

EU-komission laskelmien mukaan Ruotsin pakolaismäärä vähentyisi kiintiökaavasta riippuen 30-64 prosenttia nykyiseen verrattuna. Tämä tarkoittaisi jopa 28 000 turvapaikanhakijaa vähemmän.

EU-komissio on ehdottanut taakanjakoon EU:n sisäistä vapaaehtoista järjestelmää, mutta vastaus on ollut ei, mitä Ruotsin EU-komissaari Cecilia Malmström pitää valitettavana.

- Toivoisin, että poliittinen ilmasto olisi sellainen, mutta olemme nostaneet asian pöydälle monta kertaa ja 25 maata on täysin sitä vastaan, sanoo Cecilia Malmström.

EU-maat eivät tahdo luopua turvapaikkapoliittisesta päätöksentekovallastaan. Jopa Ruotsi, joka hyötyisi turvapaikanhakijoiden siirroista, sanoo ei. Maahanmuuttoministeri Tobias Billström uskoo, että kiintiökaavat vain lisäisivät tarpeettomia jännitteitä EU-maiden välille.

- Suhtaudun epäillen tällaisiin yksinkertaisiin ratkaisuihin kiintiöistä ja muista. On kyse oikean työkalun valitsemisesta parannusten aikaansaamiseksi, sanoo Tobias Billström.
  (käännös)
Sveriges Radio: Svårt att ändra ojämn fördelning av asylsökande (http://sverigesradio.se/sida/artikel.aspx?programid=83&artikel=5351762) 20.11.2012

Billströmistä ei ota selvää. Hän kannattaa kallista, monimutkaista ja jäsenmaiden päätösvallan kaventumiseen johtavaa EU:n yhteistä turvapaikkajärjestelmää, jonka hän toivoo tasoittavan EU-maiden väliset turvapaikanhakijaerot - jota se ei kylläkään tee - mutta sanoo suhtautuvansa epäillen siihen ainoaan ilmeiseen keinoon, joka näin tekisi, koska se on yksinkertainen ratkaisu. Onko tämä show'ta kansalaisten rauhoittamiseksi, äärimmäistä typeryyttä vai mistä on kyse?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 22.11.2012, 03:14:18
Lainaus
Efter ett decenniums nötande verkar EU nu få en gemensam asylpolitik i hela unionen. Det innebär att asylmottagandet ska bli mer lika och ansökningarna om asyl bedömas mer enhetligt. Sverige ligger idag på fjärde plats när det gäller att ta emot antal flyktingar. Det är bara Tyskland, Frankrike och Italien som tar emot flera. Och 10 länder i EU tar knappt emot några alls. Och frågan är hur den nya asylpolitiken påverkar fördelningen av asylansökningar. Hör Tobias Billström (M) migrationsminister och Susanne Palme, EU-reporter.
Sveriges Radio: Asylpolitiken i Sverige och EU (http://sverigesradio.se/sida/artikel.aspx?programid=1637&artikel=5352126) 20.11.2012

Linkin takana 15 minuutin audio, muun muassa Tobias Billströmin haastattelu, johon tuo edellisen viestin juttu perustuu.

Noin viiden minuutin kohdalla haastatellaan London School of Economicsin tutkijaa (Tilleman?), joka toteaa vastoin Billströmin väitettä, että edes yhteiset turvapaikkakäytännöt eivät johtaisi hakijamäärien tasaantumiseen EU-maiden välillä. Täydelliseen harmonisoimiseen kuluisi kauan, ja sen jälkeenkin toiset maat olisivat yhä houkuttelevampia kuin toiset johtuen esimerkiksi maiden historiasta, kielestä ja maahanmuuttajayhteisöistä. Tillemanin mukaan yhtenäisessäkin turvapaikkajärjestelmässä niihin maihin, jotka ovat muita houkuttelevampia, hakeutuisi entistä enemmän turvapaikanhakijoita. Tilleman toteaa, että mikäli EU:n tavoitteena on turvapaikanhakijoiden tasaisempi jakautuminen jäsenmaiden kesken, ei loppujen lopuksi ole oikeastaan muuta vaihtoehtoa kuin ryhtyä tosissaan neuvottelemaan turvapaikanhakijoiden "jakokaavasta" eli käytännössä jäsenmaiden turvapaikanhakijakiintiöistä.

Kyproksen EU-parlamentaarikko Kyriacos Triantaphyllides toteaa yhdeksän minuutin kohdalla, että "jakokaava" (kiintiöt) on seuraava askel, kunhan EU:n yhteiset turvapaikkasäännöt saadaan ensin voimaan. Myös ruotsalainen meppi Cecilia Wikström sanoo, ettei voimaan tuleva "turvapaikkapaketti" riitä, koska siinä ei määritellä "pakollista solidaarisuusmekanismia".

Billström kiertelee kiintiöasiaa lopuksi vähän Räsäsen malliin vetoamalla siihen, että on vaikeaa ottaa kantaa turvapaikanhakijoiden siirtoihin, koska sellaisesta ei ole tehty vielä lakiesitystä. Siksi asiaa koskeva keskustelu on vain hypoteettista, eikä Billström halua ottaa siihen osaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 22.11.2012, 12:55:45
Tervehdys, asia ei välttämättä tämän ketjun lukijoille ole uutta, mutta alla silti linkki uusimpaan blogiini EU:n yhteisestä turvapaikkapolitiikasta.
http://www.sampoterho.net/?p=2208 (http://www.sampoterho.net/?p=2208)

On se hienoa, kun tuleva Tasavallan Presidentti käy hompansseja moikkaamassa aina silloin tällöin.

Tämä taloudellinen taakanjako ja alueelliset kauhukuvat varmaan tulevaisuudessa tarkoittavat sitä, että pakolaisten kustannuksiin jyvitetään EU:lta joku tietty summa per maa ja per pakolainen. Suomen vastattava summa vastaa Suomen AAA-luokitusta ja harvaa väestöntiheyttä. Mikäli emme itse asuta suhteessa muihin maihin EU:n katsomaa määrää, maksamme kompensaatiota muille. Tämä tulee Suomelle järjettömän kalliiksi. Lisäksi en usko, että turvapaikanhakijoiden olosuhteita saadaan EU:n alueella millään yhtenäistettyä, jolloin Suomi majoittaa Siivet Oy:lle turvapaikanhakijan 200 euroa päivä, kun Kreikka samalla rahalla ruokkii 100 turvapaikanhakijaa telttaleirillä ulkoilmassa. Ne maat, joilla on paljon turvapaikanhakijoita ja huonot olot näille, lihovat EU-tukiaisillaan, kun taas Suomen tapaiset maat maksavat omista turvapaikanhakijoistaan kovaa hintaa, sekä muidenkin maiden turviksien kuluista leijonanosan.
Lisäksi kun olemme Schengenissä, ja väki liikkuu rajojen yli ilman passintarkastuksia, niin miettikääpä Kreikkaa: maata, jossa yhden saaren populaatio on sokeita ja kuolleet saavat eläkettä. Vastaisiko heidän turvapaikanhakijasaldonsa koskaan todellisuutta, kun se EU:lle ilmoitettaisiin, jos pikkuisen juksaamalla olisi mahdollisuus tienata systeemistä? (syyllistynkö nyt kansaa vastaan kiihottamiseen?)

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.11.2012, 15:52:36
Uuden Dublin-sopimuksen sisältö hyväksytty.

Lainaus
A step closer to a Common European Asylum System

The Committee of Permanent Representatives (Coreper II)  endorsed yesterday, Tuesday November 27, the outcome of the trilogue with the European Parliament held on November 14, 2012 on the pending comitology elements of the Dublin regulation and the entire text of the Regulation. Also yesterday, the Civil Liberties, Justice and Home Affairs (LIBE) Committee of the European Parliament voted in an orientation vote for the political endorsement of the full agreement.

Yesterday’s official agreement of the remaining open issues of the Dublin text concludes the long and difficult negotiations on this very important piece of legislation in the field of asylum, where many of the “political” aspects of the Regulation were agreed upon in Coreper II in the summer of 2012. The agreement on this new Dublin text (the so-called Dublin-III regulation) exemplifies the continued efforts of the Cyprus Presidency to implement the European Council’s objectives to establish the Common European Asylum System (CEAS) by the end of 2012.

The draft recast Regulation was tabled by the European Commission at the end of 2008 and negotiations proceeded for almost four years, due to the political sensitivity attached to the Regulation. The Regulation determines which Member State is responsible to examine an application of an asylum seeker who has submitted an application to more than one Member State, or an asylum seeker who has submitted an application to a Member State other than the one he/she first entered into the European Union.

Two legislative texts, part of the Common European Asylum System (the Directive of the Qualification and Status of Refugees and the Directive on the Reception Conditions for asylum seekers) have already been adopted, while the other two pending texts (the Asylum Procedures Directive and the EURODAC Regulation) are proceeding swiftly.

The Presidency is working hard to conclude the trilogues with the European Parliament in the former and is awaiting for the Parliament to adopt its position on the latter. The aim in both cases is to have a political agreement on these texts by the end of the year.

The agreement on the Dublin Regulation proves that when both co-legislators are willing to work together and to reach agreement, the European Union can achieve results which are positive for the EU and for those who are in need of international protection.

The official adoption of the Regulation will be done by the Justice and Home Affairs Council of Ministers and the Plenary of the European Parliament.
Tiedote (http://www.cy2012.eu/index.php/en/news-categories/areas/justice-and-home-affairs/press-release-a-step-closer-to-a-common-european-asylum-system) 28.11.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 07.12.2012, 21:43:26
Statewatch Analysis: The Common European Asylum System: State-of-play update (http://www.statewatch.org/analyses/no-206-asylum-procedures.pdf) 5.12.2012 (pdf)

Lainaus
A previous Statewatch analysis examined the prospects of the EU agreeing on the
legislation to establish a second-phase of a Common European Asylum System (CEAS) by
the end of 2012.

To summarise, at time of writing (5 December 2012), with less than four weeks to go to
the EU deadline, the EU has already adopted one key measure, the second-phase
qualification Directive, back in 2011. It has also adopted certain other connected
measures: an amendment to the EU refugee fund regarding resettlement (adopted spring
2012); an extension to the EU’s legislation on long-term residents to cover refugees and
persons with subsidiary protection (adopted spring 2011); and legislation establishing a
European Asylum Support Office (adopted early 2010).

[...]

Asylum procedures directive

The most recent documents available (see links below) indicate that the EP and the
Council have agreed on some of the issues which were outstanding as regards this
Directive. In particular, they have apparently agreed on:

a) several issues related to access to the procedure (Art. 6);
b) lawyers’ access to information (Art. 10(3)(c));
c) notification re personal interviews (Art. 14);
d) discriminatory requests re personal interviews (Art. 15(3)(b) and (c));
e) mandatory recording (Art. 17), where the EP has caved in to the Council’s
objections, subject to the issue being refused in future ;
f) identification of victims of torture and violence (Art. 18(4));
g) details of free information (Art. 19(1));
h) legal aid on appeal (Art. 21(2)(c));
i) representatives of unaccompanied minors (Art. 25(1));
j) time limits for accelerated procedures (Art. 31(7)); and
k) special rules on admissibility interviews (Art. 34).

However, there are a number of points still outstanding. As in the previous report, these
are listed below in two parts: (a) the points which are the most fundamental, and likely to
be the most difficult to agree; and (b) other points.

Difficult issues:
a) the issue of extradition to asylum-seekers’ countries of origin (Art. 9(2));
b) guarantees for applicants with special needs, including exceptions from some
procedural rules (Art. 24);
c) exceptions from some procedural rules for unaccompanied minors (Art. 25(6));
d) the EP’s proposed ban on detention of minors (Art. 26a);
e) the extended time period for deciding on applications (Art. 31(3));
f) whether the list of possible accelerated procedures should be exhaustive or not
(Art. 31(5));
g) ruling out certain grounds for accelerated procedures (Art. 31(8));
h) the list of possible grounds for manifestly unfounded procedures (Art. 32(2));
i) the existence of the concepts of ‘safe country of origin’, and so-called ‘super-safe third
country’ (Arts. 36, 37 and 39);
j) the rules on defining ‘safe third countries’ (Art. 38);
k) the exceptions to the right to remain following a repeat application (Art. 41); and
l) several issues relating to asylum-seekers’ status during an appeal, including the
right to stay on the territory (Art. 46).

Easier issues:
a) the definition of applicants with special procedural needs (Art. 2(d));
b) whether certain decisions must be ‘reasoned’ (Art. 4(2)(b));
c) information to applicants (Art. 8(1));
d) use of information from other international human rights bodies (Art. 10(3)(b) and (d));
e) applicants’ cooperation obligations (Art. 13(1));
f) searches of applicants (Art. 13(2)(d));
g) medical examinations of unaccompanied minors (Art. 25(4));
h) issues related to implied withdrawal of applications (Art. 28);
i) notifications of the use of emergency exceptions to the Commission (Art. 49);
j) the frequency of Commission reviews of implementation (Art. 50); and
k) the extended time period for Member States to comply with the rules on time
limits for deciding on applications (2 years or 3 years) (Art. 51(2)).

As compared to the previous state-of-play report, a large number of easier issues have
been resolved, but few difficult issues have.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.12.2012, 22:13:43
Lainaus
Keskiviikko 12. joulukuuta 2012

EU:n valmistautuminen mahdolliseen Syyriasta lähtöisin olevien turvapaikanhakijoiden tulvaan
Euroopan parlamentin esityslista (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20121212&secondRef=SIT&language=FI#D-140)

Huomatkaa sanamuoto, joka viittaa siihen mahdollisuuteen, että EU aktivoisi Syyrian tapauksessa väliaikaisen suojelun direktiivin ("tulva" on direktiivin aktivoimisen ehto), joka tarkoittaisi automaattisia oleskelulupia koko EU-alueelta ja luultavasti myös maakiintiöitä. Huomenna keskustellaan siitä, mihin toimiin EU ryhtyy, ja onko yli puoli miljoonaa maasta lähtenyttä rekisteröityä pakolaista tarpeeksi, että voidaan puhua tulvasta ("influx"), vaikka toistaiseksi vain osa heistä on saapunut Eurooppaan. Maahanmuuttokomissaari Cecilia Malmström on pitkään halunnut (http://blogs.ec.europa.eu/malmstrom/wecandomore/) EU:n ottavan vastaan enemmän syyrialaisia ja hän vaati jo arabikevään aikaan EU:ta aktivoimaan väliaikaisen suojelun direktiivin.

Yle: YK:n tiedoissa yli puoli miljoonaa Syyrian pakolaista (http://yle.fi/uutiset/ykn_tiedoissa_yli_puoli_miljoonaa_syyrian_pakolaista/6411265) 11.12.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.12.2012, 22:41:44
Nyt Ruotsin maahanmuuttoministeri Tobias Billström sanoo, että vaikka EU:n yhteinen turvapaikkajärjestelmä parantaisi heikoimpien maiden käytäntöjä, niin esimerkiksi Ruotsi pysyisi edelleen erityisen houkuttelevana maana, koska maat ovat niin erilaisia esimerkiksi työllisyydessä, eikä yhteisellä järjestelmällä voitaisi pitkään aikaan (lue: koskaan) tasata kaikkia eroja vastaanottokäytännöissä. Näinhän se tietysti maalaisjärjelläkin on, mutta tämä on vastoin sitä, että yhteistä turvapaikkajärjestelmää perustellaan juuri sillä, että se muka tasoittaisi eri maiden turvapaikanhakijamäärien erot. Eli miksi CEAS?

Riksdag&Departement: Billström varnar för att asylskillnader består (http://rod.se/billstr%C3%B6m-varnar-f%C3%B6r-att-asylskillnader-best%C3%A5r?utm_source=twitterfeed&utm_medium=twitter) 11.12.2012
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 14.12.2012, 16:18:52
Lainaus
Keskiviikko 12. joulukuuta 2012

EU:n valmistautuminen mahdolliseen Syyriasta lähtöisin olevien turvapaikanhakijoiden tulvaan
Euroopan parlamentin esityslista (http://www.europarl.europa.eu/sides/getDoc.do?type=AGENDA&reference=20121212&secondRef=SIT&language=FI#D-140)

Europarlamentissa vaadittiin keskiviikkona syyrialaisten sijoittamista EU-maihin ja esteetöntä pääsyä (Turkista) EU-alueelle.

Lainaus
EU must do more to help Syrian refugees, MEPs say

The European Union should live up to its Nobel Peace Prize by showing solidarity to Syrian asylum seekers needing protection, MEPs said in a debate with Commissioner Malmström and the Council Presidency on Wednesday evening.

Besides supplying humanitarian aid, the EU should help to set up a regional protection programme and its member states should agree to resettle some of the refugees, said MEPs in the debate.

No EU member state should be left alone to cope with a possible influx of asylum seekers, MEPs stressed, recalling what happened in Lampedusa during the Arab Spring.

The EU is currently taking in only 4% of the asylum seekers fleeing Syria, MEPs noted. Most are staying in Syria's neighbour countries. The majority of Syrians seeking asylum in Europe are currently in Germany and Sweden.

A recording of the debate is available at the link to the right.
Tiedote (http://www.europarl.europa.eu/news/en/pressroom/content/20121207IPR04421/html/EU-must-do-more-to-help-Syrian-refugees-MEPs-say), video (http://www.europarl.europa.eu/ep-live/en/plenary/video?debate=1355345391144)

edit:
Maahanmuuttokomissaari Malmström totesi puheenvuorossaan, että tilanne ei ole Syyrian suhteen vielä läheskään sellainen, että toissijaisen suojelun direktiivin aktivoiminen olisi mahdollista, vaikka etenkin Ruotsilla onkin kovia paineita. Hän tyytyikin vetoamaan jäsenmaiden vapaaehtoiseen haluun ottaa vastaan syyrialaisia. Samaan aikaan monet mepit tekevät kaikkensa, että tilanteesta tulisi vaikeampi.

Jonkinlainen linjanveto sekin, että Suomi ei ota tänne ensi vuoden pakolaiskiintiössä ainakaan ennakkosuunnitelmien mukaan ainuttakaan syyrialaista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.01.2013, 11:53:04
Lainaus
EU:n turvapaikkapaketti valmistumassa

Hedelmättömät yritykset luoda yhteiset säännöt pakolaisille koko EU:ssa ovat kestäneet yli vuosikymmenen, mutta nyt vaikuttaa siltä, että EU:n niin sanottu turvapaikkapaketti voi mennä läpi. EU-komissaari Cecilia Malmström uskoo, että yhä useammat ihmiset tulevat hakeutumaan niihin maihin, jotka nykyään eivät ota pakolaisia vastaan juuri lainkaan.

- Neuvottelut olivat todella kovia, me olemme riidelleet ja huutaneet toisillemme kokoushuoneissa, kertoo Cecilia Malmström, joka esitteli lakitekstit.

Pattitilanteesta irti pääsemiseksi oli vältettävä ideologista, tulehtunutta, edistyksen estävää maahanmuuttoväittelyä, kuten tarvitseeko Eurooppa enemmän vai vähemmän maahanmuuttoa tai onko maahanmuutto ongelma vai siunaus.

[...]

Monet [EU-maiden] hallitukset ovat pitäneet kiinni oikeudesta rajoittaa maahanmuuttoa kuten haluavat - etenkin kriisiaikoina monet hallitukset haluavat näyttää kannattajilleen, että ne pitävät ulkomaalaiset ulkona.

Mutta juuri ne maat, jotka nykyään valittavat hallitsemattomista pakolaisvirroista voivat hyötyä eniten yhteisistä säännöistä, sanoo Malmström, joka on ajanut lakipakettia kolmen vuoden ajan.

- Pitemmällä tähtäimellä uskon tämän johtavan siihen, että yhä enemmän pakolaisia menee niihin maihin, jotka eivät nykyään ota kovin monia vastaan, kuten esimerkiksi Puolaan tai Baltian maihin.

[...]

Iso-Britannia, Saksa, Ranska, Ruotsi, Hollanti ja Italia myöntävät yhteensä kolme neljäsosaa kaikista oleskeluluvista.

- Jos kaikki maat ottaisivat vastaan maahanmuuttajia täsmälleen samoilla ehdoilla, se voisi tarkoittaa, että suojelua tarvitsevat hakeutuisivat "tavallisimpien" maiden sijaan esimerkiksi Viroon, sanoo Malmström.

- Viro ottaa vastaan noin sata pakolaista - sinä ja minä olisimme Tallinnassa tummimmat ihmiset katukuvassa, hän sanoo viitaten omiin ja haastattelijan tummiin hiuksiin.

[...]

Viranomaisten täytyy haastatella kaikki turvapaikanhakijat ja antaa päätös kolmen kuukauden sisällä, mutta päätöksestä on voitava myös valittaa. Turvapaikanhakijat saavat halutessaan ilmaista oikeusapua sillä kielellä, jota ymmärtävät. Heitä saa pitää säilössä vain jos he ovat uhka itselleen tai muille ja silloinkin enintään kolmen kuukauden ajan.

[...]

Yksi turvapaikkapaketin hankalimmista kohdista oli muuttaa niin sanotun Dublin-sopimuksen sääntöjä. Se määrittelee, että turvapaikanhakijan hakemus käsitelleen ensimmäisessä EU-maassa, johon hän saapuu. Säännöt kirjoitettiin uusiksi siten, että turvapaikanhakijaa ei koskaan saa lähettää takaisin maahan, jossa häntä voi odottaa "halventavat tai epäinhimilliset olot", vaikka se olisikin ensimmäinen vastaanottajamaa.

Tämä osio lisättiin, koska monissa tapauksissa Dublin-säännöt olisivat tarkoittaneet, että siirtolaiset olisivat odottaneet päätöstä täysissä ja epähygieenisissä, vankilan kaltaisissa leireissä EU:n reuna-alueilla kuten Kreikassa, Italiassa ja Maltalla, jossa viranomaiset tai henkilökunta olisivat kohdelleet heitä huonosti.

Päätöstään odottavat turvapaikanhakijat saavat turvapaikkapaketin mukaan myös luvan tehdä töitä ja maksaa veroja(käännös)
Svenska Dagbladet: EU:s asylpaket på väg (http://www.svd.se/nyheter/utrikes/eus-asylpaket-pa-vag_7807808.svd)  9.1.2013

On mieletön väite, että muutokset (mm. Dublin-sopimuksen vähittäinen purkaminen) helpottaisivat kuormitetuimpien maiden taakkaa. Tilanne päinvastoin pahenee, kun laittomien siirtolaisten ei enää tarvitse pelätä säilöönottoja ja palautuksia Kreikkaan ja Italiaan. Mitä helpommaksi turvapaikanhaku ja EU-alueella shoppailu tehdään, sitä halvempaa siitä tulee ja sitä enemmän turvapaikanhakijoiden ja laittomien siirtolaisten määrä kasvaa kaikkialla Euroopassa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RP - 11.01.2013, 12:04:57
Pattitilanteesta irti pääsemiseksi oli vältettävä ideologista, tulehtunutta, edistyksen estävää maahanmuuttoväittelyä, kuten tarvitseeko Eurooppa enemmän vai vähemmän maahanmuuttoa tai onko maahanmuutto ongelma vai siunaus.

Hankalapa olisikin argumentoida sen puolesta, että humanitäärinen maahanmuutto (nykymuodossaan Euroopaaan, en puhu juutalaisten professorien vastaanotosta Yhdysvaltoihin menneellä vuosisadalla) olisi vastaanottajalleen siunauksellista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.01.2013, 12:11:47
Komissaari Malmström siis tuossa ylpeili, että sääntöjä rukatessa onnistuttiin keskittymään pelkästään teknisiin yksityiskohtiin yksi kerrallaan ja vältettiin tietoisesti "poliittista" keskustelua muutosten seurauksista, jotta varmistettaisiin suurhankkeen edistyminen. Hullua, mutta niin kuvaavaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 11.01.2013, 12:17:18
Komissaari Malmström siis tuossa ylpeili, että sääntöjä rukatessa onnistuttiin keskityttymään pelkästään teknisiin yksityiskohtiin yksi kerrallaan ja vältettiin tietoisesti "poliittista" keskustelua muutosten seurauksista, jotta varmistettaisiin suurhankeen edistyminen. Hullua, mutta niin kuvaavaa.

Jotta tuon suoraan tunnustaa, eikä yritä moista edes peitellä ja kieltää (mikä olisi ihmiselle psykologisesti ja järjellä ajateltuna normaalimpi tapa toimia ja puhua), kertoo vahvasta (sairaasta) voiman tunteesta ja itsekeskeisyydestä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Whomanoid - 11.01.2013, 12:21:24
Olisipa mielenkiintoista nähdä mitä tapahtuisi, jos Puolaan tai Baltian maihin pöllähtäisi lyhyessä ajassa muutamia kymmeniä tuhansia somaleja, kurdeja ja arabeja. Voisivat venäläiset ja virolaiset/latvialaiset nationalistit yllättäen löytää toisensa samalta puolelta. Luultavasti näissä maissa rasismi ei jäisi huutelun asteelle.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Teemu Niva - 11.01.2013, 17:41:18
Tein tämmöisen blogauksen, CEAS, päivitystä tilanteeseen (http://teemu-niva.ehdolla.fi/blogi/2013/01/11/53/?page2), jossa pyrin saamaan tiiviin paketin loppuvuoden tapahtumista asian tiimoilta.

Bongaatteko korjattavaa?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RP - 12.01.2013, 03:46:14
Bongaatteko korjattavaa?

Paljonkin, en tosin valitettavasti blogitekstissä....
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 12.01.2013, 10:03:48
Hallitus toteuttaa CEAS:in vaatimia muutoksia Suomen lainsäädäntöön ks. Sisäministeriön lainsäädäntösuunnitelma 2013-2017 (http://hommaforum.org/index.php/topic,78160.0.html).

CEAS näkyy myös mitä ilmeisimmin 2011-12-22 Maahanmuuton tulevaisuus 2020 -strategian (http://hommaforum.org/index.php/topic,63882.0.html) linjauksissa.

Tuossa ovat kai keskeisimmät kanavat, joilla CEAS realisoituu osaksi Suomen valtion läinsäädäntöä ja viranomaistoimintaa. Lisäksi muillakin kuin sisäasiainministeriöllä on oma roolinsa, ilmeisesti vähäisemmät.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 22.01.2013, 13:03:59
Lainaus
Yhteistä eurooppalaista turvapaikkajärjestelmää koskeva lakihanke käynnistyy

Sisäministeriö on asettanut hankkeen, jonka tavoitteena on saattaa Suomen lainsäädäntö vastaamaan eräitä yhteistä eurooppalaista turvapaikkajärjestelmää koskevia, uudelleen laadittuja EU-säädöksiä. Lainmuutosten on tarkoitus tulla voimaan viimeistään vuonna 2015.

Hankkeessa selvitetään, mitä muutostarpeita direktiivit ja asetukset aiheuttavat kansallisella tasolla. Hankkeessa valmistellaan myös tarvittavat, pääasiassa ulkomaalaislakia koskevat muutosehdotukset.

Hankkeen aluksi keväällä 2013 tehdään määritelmädirektiiviä koskeva selvitys. Määritelmädirektiivin lisäksi hankkeessa käsitellään turvapaikkamenettelydirektiiviä sekä vastuunmäärittämis- ja Eurodac-asetuksia.

Yhteisen eurooppalaisen turvapaikkajärjestelmän säädöskokonaisuuteen kuuluu myös uudelleen laadittu vastaanottodirektiivi, mutta sen täytäntöönpano toteutetaan eri hankkeessa, koska sen vaikutukset kohdistuvat pääasiassa vastaanottolakiin.

Taustaa lyhyesti

Määritelmädirektiivissä määritellään, ketkä voivat saada kansainvälistä suojelua EU-maissa. Siinä säädetään myös kansainvälistä suojelua saaville annettavista oikeuksista ja etuuksista. Direktiivi on annettu 13.12.2011 ja se on saatettava kansallisesti voimaan joulukuuhun 2013 mennessä.

Turvapaikkamenettelydirektiivissä säädetään kansainvälisen suojelun myöntämistä koskevista menettelyistä EU-maissa. Direktiivin sisällöstä ollaan pääsemässä EU-tasolla yhteisymmärrykseen. Direktiivin odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana, jolloin se olisi saatettava kansallisesti voimaan kevään 2015 aikana.

Vastuunmäärittämisasetus (Dublin II) määrittää sen, minkä maan vastuulla on käsitellä jäsenvaltioiden alueella jätetty kansainvälistä suojelua koskeva hakemus. Asetuksen sisällöstä on päästy poliittiseen yhteisymmärrykseen EU-tasolla ja sen odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana.

Eurodac-asetuksella on perustettu Eurodac-sormenjälkijärjestelmä, jonka päätarkoituksena on tehostaa vastuunmäärittämisasetuksen soveltamista. Asetuksen sisällöstä ollaan pääsemässä yhteisymmärrykseen ja sen odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana.

Hankkeen toimikausi on ajalla 15.1.2013 - 31.5.2015.

Lisätietoja hankkeesta ja sen asetuspäätöksestä: http://www.intermin.fi/fi/lainvalmistelu/muut_lainvalmisteluhankkeet/yhteinen_eurooppalainen_turvapaikkajarjestelma

Lisätietoja: neuvotteleva virkamies Sanna Sutter, 071 878 8633
Sisäasiainministeriö (http://www.intermin.fi/fi/ajankohtaista/uutiset/maahanmuutto/1/0/yhteista_eurooppalaista_turvapaikkajarjestelmaa_koskeva_lakihanke_kaynnistyy) 22.1.2013

Turha luullakaan, että tuolla sisäministeriön sivuilla selvitettäisiin edes yleisellä tasolla, mitä muutoksia turvapaikkapaketin hyväksyminen merkitsee ja mitä seurauksia niillä voi Suomen ja EU:n kannalta ennakoida olevan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 22.01.2013, 17:30:26
Turha luullakaan, että tuolla sisäministeriön sivuilla selvitettäisiin edes yleisellä tasolla, mitä muutoksia turvapaikkapaketin hyväksyminen merkitsee ja mitä seurauksia niillä voi Suomen ja EU:n kannalta ennakoida olevan.

Päätösten tekeminen ilman vaikutusten ja vaihtoehtojen arviointia on merkki huonosta hallinnosta. Mielestäni tämän kaltaisesta toiminnasta olisi hyvä tehdä kirjallinen kysymys, joka pakottaa ottamaan kantaa vaihtoehtoihin ja vaikutuksiin.

Lainaus
http://en.wikipedia.org/wiki/Decision_making

Decision making

    Objectives must first be established
    Objectives must be classified and placed in order of importance
    Alternative actions must be developed
    The alternative must be evaluated against all the objectives
    The alternative that is able to achieve all the objectives is the tentative decision
    The tentative decision is evaluated for more possible consequences
    The decisive actions are taken, and additional actions are taken to prevent any adverse consequences from becoming problems and starting both systems (problem analysis and decision making) all over again
    There are steps that are generally followed that result in a decision model that can be used to determine an optimal production plan.[5]
    In a situation featuring conflict, role-playing is helpful for predicting decisions to be made by involved parties.[6]

Decision planning

Making a decision without planning is fairly common, but does not often end well. Planning allows for decisions to be made comfortably and in a smart way. Planning makes decision making a lot more simple than it is. Decision will get four benefits out of planning: 1. Planning give chance to the establishment of independent goals. It is a conscious and directed series of choices. 2. Planning provides a standard of measurement. It is a measurement of whether you are going towards or further away from your goal. 3. Planning converts values to action. You think twice about the plan and decide what will help advance your plan best. 4. Planning allows for limited resources to be committed in an orderly way. Always govern the use of what is limited to you. (e.g. money, time, etc.)[7]
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 22.01.2013, 17:49:13
Päätösten tekeminen ilman vaikutusten ja vaihtoehtojen arviointia on merkki huonosta hallinnosta. Mielestäni tämän kaltaisesta toiminnasta olisi hyvä tehdä kirjallinen kysymys, joka pakottaa ottamaan kantaa vaihtoehtoihin ja vaikutuksiin.

Ensin suomalaiset päättäjät tekivät päätöksen, että taivutaan tulevaan yhteiseen EU-päätökseen. Sitten tutkitaan, mitä muutoksia tämä pakottaa tekemään Suomen lakeihin. Vasta sen jälkeen, jos sittenkään, arvioidaan muutosten vaikutuksia.

Ihan yksinkertainen kysymys: miten tässä päätöksessä otettiin huomioon Suomen etu? Netistä kaivettujen ennakkotietojen perusteella muutosten vaikutukset ovat Suomelle (ja paradoksaalisesti suurimmalle osalle muistakin jäsenmaista) haitallisia ja muutokset rajoittavat Suomen maahanmuuttopoliittista päätösvaltaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: M.K.Korpela - 22.01.2013, 19:51:17
Netistä kaivettujen ennakkotietojen perusteella muutosten vaikutukset ovat Suomelle (ja paradoksaalisesti suurimmalle osalle muistakin jäsenmaista) haitallisia ja muutokset rajoittavat Suomen maahanmuuttopoliittista päätösvaltaa.

 
Lainaus käyttäjältä: SVT
Det är inte nödvändigtvis Sverige som behöver göra mindre, men det finns andra som definitivt behöver göra mycket mer, säger migrationsminister Tobias Billström.

Sylttytehdas (http://sverigesradio.se/sida/artikel.aspx?programid=3993&artikel=5341339)

Ainakaan ei kuulosta hyvältä, että Ruotsin ei tarvitse "tehdä vähemmän" mutta muiden "on tehtävä paljon enemmän". Ruotsi valitsi komissaarinpaikkansa hyvin strategisesti, ja Cecilia Malmström on tehnyt erinomaista tuhoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 23.01.2013, 10:38:23
Päätösten tekeminen ilman vaikutusten ja vaihtoehtojen arviointia on merkki huonosta hallinnosta.

Meillä onkin käytössä hyvin edistyksellinen kokeellinen hallintokulttuuri.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 23.01.2013, 23:13:18
Lainaus
Tarja Cronberg: Korvaako rajavalvonta maahanmuuttopolitiikan?

Keskellä talouskriisiä EU suunnittelee valtavaa panostusta rajavalvontaan. Niin kutsutun Eurosur-ohjelman tarkoituksena on partioida Euroopan ulkorajoja viimeisimmällä tekniikalla, muun muassa miehittämättömillä lennokeilla. Eurosurin hinta olisi lähes 400 miljoonaa euroa.

Jäsenmaat myös kehittävät niin sanottuja älykkäitä rajoja saadakseen rajojen ylitykset 100-prosenttiseen kontrolliin. Massiivinen tietopankki säilyttäisi kaikki tiedot – sormenjäljet mukaan lukien – kaikilta, jotka tulevat Unioniin tai lähtevät sieltä. Tällöin saataisiin täydellinen kuva niistä, jotka kullakin hetkellä ovat laittomasti maassa. Hintalappu on 1,1 miljardia euroa.

[...]

Vaikuttaa pahasti siltä, että EU:ssa teknologialla korvataan yhteisen turvapaikkapolitiikan ja maahanmuuttopolitiikan puutteet. Yhteistä maahanmuuttopolitiikkaa ei odotuksista huolimatta ole saatu aikaan vuoteen 2012 mennessä, mikä oli tavoite.

Uudella järjestelmällä on selviä vaikutuksia ihmis- ja perusoikeuksiin. Frontexia on kritisoitu niin sanotuista push-back-operaatioissa, joissa pakolaislaivat tutkimatta palautetaan lähtömaahan. Jos pakolaisia täynnä oleva laiva voidaan havaita lennokilla Pohjois-Afrikan rannikon ulkopuolella, ei se välttämättä johda ihmisten pelastumiseen, vaan nopeampaan käännytykseen. Toisaalta juuri pelastamista on tarkoituksellisesti käytetty perusteluna tehokkaammalle rajavalvonnalle.

Euroopan ihmisoikeustuomioistuin on tuominnut muun muassa Italian palautusoperaatioista. Kansalaisjärjestöt ovat olleet huolissaan nimenomaan Frontexin toimista, joissa on rikottu esimerkiksi oikeutta hakea turvapaikkaa, tai yksityisyyden suojaa antamalla henkilötietoja kolmannelle taholle. Jäsenmaat ja Frontex molemmat ovat rikkoneet maahanmuuttajien oikeuksia. Yhteisille pelisäännöille on tarvetta.

Tällä hetkellä Suomessa irtisanotaan rajavalvojia. Jos samanaikaisesti panostetaan miljardeja rajavalvonnan automatisointiin, ei se välttämättä paranna rajavalvontaa. Päinvastoin, inhimillinen tekijä jää pois, ja rajavalvonnasta tulee täysin mekanisoitua. Tällöin myös organisoidulla rikollisuudella on helpompi löytää tapoja ylittää rajat samanaikaisesti, kun turvapaikkaan oikeutettuja palautetaan alkuperäismaahan.

Tällä hetkellä rajavalvontalainsäädännöstä käydään keskustelua niin Euroopan neuvostossa kuin parlamentissakin. Sen sijaan, että yritettäisiin löytää ratkaisua inhimillisempään ja yhteiseen turvapaikka- ja maahanmuuttopolitiikkaan, panostetaan kovaan valvontateknologiaan.
Tarja Cronbergin blogi (http://www.tarjacronberg.fi/mep-blogi.php?id=130123162629C046&archive=0) 23.1.2013

Lainaus
Tarja Cronberg ihmettelee miljardien syytämistä rajavalvontaan tilanteessa, jossa Eurooppaa kurittaa esimerkiksi kova nuorisotyöttömyys.

– Meillä on menossa ehkä päinvastainen liike, että täältä lähdetään pois sen takia, että Euroopassa ei löydy nuorille työtä. Ja jos katsotaan Euroopan parlamentin tasolla, niin rahaa olisi tällä hetkellä parempi käyttää nuorisotyöttömyyden ehkäisemiseen. Mutta jos katsotaan, että se raha pitää laittaa rajavalvontaan, niin silloin katsoisin, että rajavalvojien lisääminen on se oikea tapa.
MTV3: EU tehostaa otettaan Schengen-alueen ulkorajoilla (http://www.mtv3.fi/uutiset/kotimaa.shtml/2013/01/1696187/eu-tehostaa-otettaan-schengen-alueen-ulkorajoilla) 23.1.2013

Europarlamentaarikko Tarja Cronbergiä selvästi hiertää, että uuden järjestelmän ennakoidaan vähentävän laitonta siirtolaisuutta, jonka hän katsoo eräänlaiseksi saavutetuksi eduksi. Tekosyyt järjestelmän vastustamiseksi (liian kallista talouskriisin aikaan, helpottaa organisoitua rikollisuutta, rahat mieluummin nuorisotyöttömyyden torjuntaan) ovat huvittavan läpinäkyviä, etenkin kun yksi hänen päähuolenaiheistaan eli Kreikan kriisin paheneminen johtuu ei vähiten juuri vuosia jatkuneesta hallitsemattomasta laittomasta siirtolaisuudesta.

Cronberg tai kukaan muukaan EU:n yhteistä turvapaikka- ja maahanmuuttopolitiikkaa ratkaisuksi tarjoava (maahanmuuttokomissaari Cecilia Malmström ensimmäisenä) ei ole pystynyt esittämään, kuinka kaavailtu yhteinen politiikka voisi teoriassakaan ratkaista tai edes helpottaa nykyisiä maahanmuuton ongelmia. Tämän myöntää kautta rantain myös Ruotsin maahanmuuttoministeri Tobias Billström.

Itsenäiselle valtiolle olennaisen maahanmuuttopoliittisen päätösvallan luovuttaminen EU:lle tarkoittaisi jo selvästi liittovaltiota. Mikä pahinta, sen vastineeksi ei saataisi mitään Suomea hyödyttävää, vaan päinvastoin nurkan takana olisivat "pakollisen solidaarisuuden" nimissä odottamassa muun muassa jo parikymmentä vuotta kaavaillut jäsenmaiden turvapaikanhakijakiintiöt muodossa tai toisessa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Teemu Niva - 24.01.2013, 10:00:47
http://www.hare.vn.fi/mHankkeenTaustatietojenSelailu.asp?h_iID=19114&tVNo=2&sTyp=Selaus
Lainaus
Valtioneuvoston asettama hanke:    Ei
Hankkeen suhde hallitusohjelmaan:    Ei
Hankkeen suhde hallitusohjelmaan, kuvaus:   
Hankkeen suhde talousarvioon:    Ei
Hankkeen suhde talousarvioon, kuvaus:   
Hankkeen suhde Suomen lainsäädäntöön:    Ei
Hankkeen suhde Suomen lainsäädäntöön, kuvaus:   
Hankkeen suhde EU:n lainsäädäntöön:    Ei
Hankkeen suhde EU:n lainsäädäntöön, kuvaus:   
HE:n kiireellisyys:    Ei
Kiireellisyyden peruste:   
Ajankohta, jolloin HE tullee VN:oon:   
Istuntokausi, jolloin HE annetaan eduskunnalle:   
Sisältyy lainsäädäntösuunnitelmaan:
(Vanhasen II hallitus)    Ei
Lisätiedot:   
Päähanke:   
Aihealueet:    
Asiasanat:    
Asettamispäätöksen allekirjoittajat:    Pentti Visanen, Osastopäällikkö, ylijohtaja
Sirkku Päivärinne, Maahanmuuttojohtaja
Asettamispäätöksen liitteet:   

Kuvaa aika hyvin sitä että, miten paljon Suomella on ollut sananvaltaa tässä(kin) asiassa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: gloaming - 24.01.2013, 11:13:54
Jos miljardin sijoitus ehkäisee satojen miljardien kustannukset sosiaalijärjestelmälle, hintaa voidaan pitää naurettavan halpana.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Toni R Jyväskylästä - 28.01.2013, 00:29:09
Mutta jos tuet olisivat täysin samat kaikissa eu-maissa, niin eihän ne välttämättä tänne kylmään, pimeään, rasistiseen pohjolaan tulisi vaan jäisivät etelä/keski-eurooppaan. Käsittämättön kalliiksihan tämä tulee joka tapauksessa ja huonontaa varmasti toteutuessaan kansallista turvallisuutta huomattavasti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.01.2013, 20:41:55
Lainaus
Asylum seminar

The EP's press service is holding a seminar for journalists on Wednesday on the establishment of the Common European Asylum System.  Journalists will have the opportunity to discuss the EU asylum legislation with MEPs and representatives of other EU institutions. Some parts of the legislation have already been adopted and the whole package is expected to be finalised within the next few weeks.
EP this week: economy talks, Somalian president, Plenary preparations (http://www.europarl.europa.eu/news/en/headlines/content/20130125STO05484/html/EP-this-week-economy-talks-Somalian-president-Plenary-preparations) 28.1.2013

Lainaus
Seminar for journalists

EU asylum legislation
The establishment of a Common European Asylum System

Wednesday 30 January 2013, 10:00 - 16:30 hrs
Room 4 B 001, Paul-Henri Spaak building, European Parliament, Brussels

Draft programme

from 09:30
Arrival and registration
(Altiero Spinelli building, entrance via Agora Simone Veil)

10:00- 10:30 Opening and introduction to the seminar
Yannis Darmis & Paula Fernández Hervás, EP officials, Press Service
An introduction to the European Parliament
Decision-making in the European Union and the role of the Parliament
Jack Blackwell, EP official, Press Service

10:30 - 11:45 Asylum: introductory briefing on the legislation (off-the-record)
Alex Walford, European Commission official
John O’Dwyer, Council Presidency-in-Office
Patricia Van de Peer, EP official, secretariat of Civil Liberties, Justice and
Home Affairs Committee
Natalia Dasilva, EP press officer for Civil Liberties, Justice and Home Affairs
Q&A session

11:45 - 12:30 Stakeholders: the view from the front line
Moderated by Jack Blackwell, EP official, Press Service
Melita Sunjic, Senior Regional External Relations officer, The UN Refugee
Agency (UNHCR)
Ana López Fontal, Senior Press and Public Information Officer, The
European Council on Refugees & Exiles (ECRE)
Q&A session

12:30 - 14:00 Reception
Paul-Henri Spaak building, 5th floor
Interpretation in EL - EN - ES - FR - IT - PT (from 10:00 - 16:30)

14:00 - 16:30 The EU asylum package: debate with MEPs
Moderated by Michel Plumley, EP official, Press Service
MEP Antonio MASIP HIDALGO (S&D, Spain), rapporteur on minimum
standards for the reception of asylum seekers
MEP Cecilia WIKSTRÖM (ALDE, Sweden), rapporteur on Dublin II regulation
MEP Rui TAVARES (Greens/EFA, Portugal), rapporteur on joint EU
resettlement programme
EPP representative (tbc)
MEP Timothy KIRKHOPE (ECR, United Kingdom), group coordinator
MEP Mario BORGHEZIO (EFD, Italy), group coordinator
MEP Kyriakos TRIANTAPHYLLIDES (GUE/NGL, Cyprus), group
coordinator
Q&A session

* * * * *

16:40 - 17:30 Special session for audiovisual media - Presentation of the EP's
audiovisual media services and technical facilities
Room -2Q129, József Antall building
or
16:40 - 17:40 Visit to the Parlamentarium (EP Visitors Centre)

Lainaus
Lähetyksen alku: 30. tammikuuta 14:00
http://www.europarl.europa.eu/ep-live/fi/other-events/video?event=20130130-1400-SPECIAL-UNKN
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: RTT - 29.01.2013, 19:19:19
Lainaus
Political parties drive hate in EU, commission says

Far-right political discourse is feeding hatred throughout the EU and could harm the European project in the upcoming 2014 European Parliament elections, says the European Commission. Disparaging words geared towards minority groups like Roma, Muslims, Jews and immigrants are becoming more common as elected officials attempt to woo a growing number of the voting electorate rooted in populist movements. 

"Not since World War II have extreme and populist forces had so much influence on the national parliaments as they have today. In some countries even neo-nazis have been elected," said EU home affairs commissioner Cecilia Malmstrom in Brussels on Monday (28 January).
--
Malmstrom warned that racist and nationalistic politics could gain a stronger foothold in the European Parliament after elctions in 2014.

"We must not underestimate the importance of what this would mean for the European project," said the commissioner.

Such political discourse may also inspire "lone wolves" to carry out indiscriminate killings as the threat of violent extremism spreads, she noted.

The commissioner said organised terrorist networks have given way to protagonists such as Anders Breivik, a Norwegian whose lone attack saw the murder of 77 people in 2011.
EUobserver: Political parties drive hate in EU, commission says (http://euobserver.com/justice/118873)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.01.2013, 20:09:18
Political parties drive hate in EU, commission says

Cecilia Malmströmin koko puhe:
Opening speech: Empowering local actors to prevent violent extremism (http://europa.eu/rapid/press-release_SPEECH-13-71_en.htm?locale=en) 29.1.2013

Lainaus käyttäjältä: Cecilia Malmström
It is about time we recognise the truth about the growing trends of extremism in Europe, which makes it one of the main – if not the main – security challenge to Europe.

Violent extremism is more than the threat from extreme islamist groups such as Al Qaida. Violent extremism can arise within any ideology, and the threat today mainly comes from within our own societies, as we saw in the cases of Norway and France.

The growing populist, nationalist and xenophobic movements across Europe are a concern to all of us. Extremists are not as easily identifiable as they perhaps once were. Now they also reveal themselves amongst us – they permeate our online environments and to a growing extent even European politics.

These extremist groups and political movements often act as a breeding ground for ideology-motivated violence. I am not saying that these movements are directly responsible for terrorist attacks, but we must acknowledge that they provide oxygen - and increasing acceptance - for extremist views.

We will not be able to counter violent extremism if we don't counter the propaganda of those who support extreme, xenophobic and racist views.

Entä kuinka meidän tulisi "kohdata äärimmäisiä mielipiteitä, muukalaiskammoa ja rasistisia näkemyksiä kannattava propaganda"? Komissaari Malmström ehdottaa t-paitojen jakamista uusnatseille:
Sveriges Radio: T-shirts i kampen mot terrorism i EU (http://sverigesradio.se/sida/artikel.aspx?programid=83&artikel=5424443) 28.12.012

Malmströmin keskustelukerhon 15 ehdotusta väkivaltaisen ekstremismin estämiseksi:
Lainaus
15. At local and/or national level, prepare for de-stigmatising communication by authorities
following an attack
. To prevent escalation after an attack, it is important to have a clear view on
how to communicate without causing unnecessary stigmatisation. Labelling, misusing terms or
stigmatising one category of population may have terrible side effects.
Those who take part in the
public debate should be aware that the perceptions that public debate leaves in society can escalate
or mitigate the level of conflict.
Discussion paper: “Empowering local actors to prevent violent ekstremism” (http://ec.europa.eu/dgs/home-affairs/what-we-do/networks/radicalisation_awareness_network/ran-high-level-conference/docs/hlc_discussion_paper_en.pdf) (pdf) 29.1.2013
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.01.2013, 00:03:12
Deutche Welle: Still no sign of a common asylum policy in the EU (http://www.dw.de/still-no-sign-of-a-common-asylum-policy-in-the-eu/a-16512690) 10.1.2013

Sopimus on kylläkin viimeistelyä vaille valmis...

Lainaus
For years, the European Union has said it wants a common policy on asylum. So far, all attempts to create one have failed as a result of what members states see as their national interests.

The European Union has had the goal of achieving a common asylum policy for the last 13 years - ever since 1999, when its then 15 heads of government were confronted with the influx of refugees from the Yugoslav wars. Some countries, like Germany and Austria, were seriously affected, while others were scarcely troubled by the conflict.

Now it's Greece that has to receive the largest number of refugees, although Malta and Cyprus also complain that they have to bear too large a share of the burden. The distribution of refugees remains very uneven.

Ei pidä paikkaansa. Kreikka ei ota vastaan läheskään eniten pakolaisia tai turvapaikanhakijoita. Siellä on kyllä väestömäärään suhteutettuna paljon laittomia siirtolaisia, mutta vain harva heistä laskettaisiin muuallakaan pakolaiseksi.

Lainaus
Currently the so-called Dublin II regulations require countries to take responsibility for the asylum process for any refugees who arrive in Europe via their territory. Refugees who then go to another country can be sent back to the country they arrived in.

That's why the countries which are the first ports of call for refugees - like Greece - want to change Dublin II. Meanwhile, the German interior minister, Hans-Peter Friedrich, doesn't want a change, since he fears that all the refugees would come to Germany.

Dublin-palautusten määrä on melko pieni verrattuna turvapaikanhakijoiden määrään. Sen suurin merkitys lieneekin turvapaikkashoppailijoiden pelotteena. Kymppitonnin maksulla ei välttämättä pääsekään juuri siihen maahan, johon haluaisi. Epävarmuus vähentää tulijoiden määrää.

Lainaus
Nadja Hirsch, a Free Democratic member of the European Parliament's Committee for Labor and Social Affairs, thinks the Dublin system doesn't make sense because "families are torn apart and individual countries have to take in far more people just because of their geographical location."

She told Deutsche Welle that "refugees should be distributed among the EU member states according to a quota."

She believes such a quota system wouldn't make much difference for Germany, since the country already takes in a large number of refugees. Sweden, she says, makes a particularly large contribution, while Hungary, the Czech Republic and Spain do far less than they could.

Saksa ei tosiaankaan suoraan häviäisi kiintiöjärjestelmässä, sillä Saksa ei hyväksyisi sellaista kiintiöjärjestelmää, jossa se häviäisi. On Saksasta kiinni, millä kaavalla kiintiöt laskettaisiin.

Mutta miksi muut maat suostuisivat turvapaikanhakijoiden siirtoihin? Sen sijaan ihan yksinkertaisesti sisärajojen henkilöllisyystarkastukset palauttamalla turvapaikanhakijoiden määrä vähentyisi merkittävästi kaikissa EU-maissa.

Lainaus
Hirsch, though, says that one problem in Germany is that refugees are not allowed to work, and so they are seen as a burden on the state. Sweden, she says, offers a much better example: "They have a much more liberal employment policy. People can get jobs as soon as they are able. That means they cost the state nothing, the people are integrated and they even contribute to economic growth with their work."

Niin, paitsi että oikeasti turvapaikanhakijat tulevat Ruotsille työntekomahdollisuudesta huolimatta äärimmäisen kalliiksi, eivätkä integroidu.

Lainaus
Hirsch has an ally in the EU Commissioner for Home Affairs, Cecilia Malmström, who pleads for greater openness towards refugees in Europe. Malmström points out that the EU in any case has an obligation towards those requiring protection, and that the aging European societies have an interest in attracting immigrants - even those without refugee status. Most politicians disagree.

EU:n velvollisuudet suojelua tarvitsevia kohtaan eivät tarkoita, että EU:n pitäisi asuttaa suojelun tarpeeseen vetoavat nimenomaan Eurooppaan. EU:n velvollisuudet suojelua tarvitsevia kohtaan eivät tarkoita myöskään sitä, että piikki on nyt ja tulevaisuudessa auki. Johonkin täytyy vetää raja.

Aivan kaistapäistä on väittää, että EU muka tarvitsee tällaista maahanmuuttoa väestörakenteen korjaamiseksi. Vaikka asiaa miten kääntää, nykymuotoinen humanitaarinen maahanmuutto on eurooppalaisilla kohdemaille haitallista. Se voi parantaa väestöllistä huoltosuhdetta, mutta ei paljon, eikä sillä ole merkitystä, sillä se rasittaa yhä enemmän taloudellista huoltosuhdetta ja tämä rasite kumuloituu pitkälle tulevaisuuteen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 06.02.2013, 13:36:47
Euroopan neuvoston parlamentaarisen yleiskokouksen näkemystä Kreikan rajavalvonnasta, laittomasta maahanmuutosta ja EU:n yhteisestä maahanmuuttopolitiikasta:

PACE: Migration and asylum: mounting tensions in the Eastern Mediterranean (http://www.ein.org.uk/news/pace-says-europe-must-help-turkey-and-greece-tackle-irregular-migration-storm) 23.1.2013

Raportin perusteella kyse ei selvästikään ole tiedon puutteesta. Faktat kuitenkin joko jätetään huomiotta tai niistä tehdään epäloogisia johtopäätöksiä. Rajavalvonta vaikuttaa kirosanalta silloinkin, kun se on tuottanut myönteisiä tuloksia. Ratkaisuksi maahanmuuton ongelmiin ehdotetaan moneen kertaan EU:n yhteistä turvapaikkapolitiikkaa ja turvapaikanhakijoiden uudelleensijoittamisia toisiin EU-maihin. Hankkeiden seurauksia jäsenmaille ja vaikutusta turvapaikanhakijoiden määrään ei käsitellä lainkaan.

Turvapaikanhakijoiden siirtely ei selvästikään ole mikään ratkaisu, koska jäsenmaat eivät halua sitä. Myöskään CEAS ei toteutuessaankaan ratkaisisi ongelmia, vaan pahentaisi niitä, koska se lisäisi turvapaikanhakijoiden ja laittomien siirtolaisten määrää kaikkialla Euroopassa.

Lainaus
While these policies have helped reduce considerably the flow of arrivals across the Evros border with Turkey, they have transferred the problem to the Greek islands and have not helped significantly in dealing with the situation of irregular migrants, asylum seekers and refugees already in Greece. The building of a greater number of detention centres has not helped significantly either.

Lainaus
It is necessary, in this context to recognise that persons caught up in these mixed migratory flows are not intending to stay in Turkey or in Greece when they arrive; they are primarily looking to reach European Union member States other than Greece.

Lainaus
The process of European unity and the Common European Asylum System is based on solidarity and mutual support. Without this the process is void of meaning and cannot succeed.

Lainaus
Taking into account the responsibility of the European Union, the Assembly calls on it to make a quantum leap on responsibility sharing for countries in the region.

Lainaus
revise and implement the Dublin Regulation in a way that provides a fairer response to the challenges that the European Union is facing in terms of mixed migration flows.

Lainaus
As a result of the economic crisis and austerity measures, the unemployment rate in October 2012 of the Greek population reached 26,8% and youth unemployment climbed as high as 56,6%.

Lainaus
The mounting social tensions and the inadequate response by the State to address the difficult social situation of migrants, asylum seekers and refugees have led to an increase in criminality and exploitation of this group.

Lainaus
A shared asylum policy that takes into account that the migratory pressures are not the sole responsible of one or a few European States, but a European problem, is even more essential in a time when the region is facing major instability.

Lainaus
A shared asylum and migration policy is even more essential at a time when the region is facing major economic and social instability.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 12.04.2013, 14:46:14
Lainaus
EU:n uusi yhteinen turvapaikkapolitiikka on ottanut pitkän askeleen kohti toteutumista. Uuden politiikan mukaan kaikkia pakolaisia kohdellaan jäsenmaissa samalla tavalla. Ruotsin hallitus toivoo, että tämä johtaa turvapaikkahakemusten tasaisempaan jakautumiseen jäsenmaiden kesken.

Andreas Ollinen, maahanmuuttoministeri Tobias Billströmin poliittinen neuvonantaja, ei usko, että EU:n yhteinen turvapaikka- ja maahanmuuttopolitiikka tarkoittaa suurempia muutoksia Ruotsille. Mutta toive on, että se tarkoittaa turvapaikanhakijoiden tasaisempaa jakamista jäsenmaiden välillä.
– Meillähän on tilanne, jossa viisi jäsenmaata ottaa vastaan 70 prosenttia kaikista Eurooppaan saapuvista turvapaikanhakijoista. Se tarkoittaa, että 22 jäsenmaata ottaa vastaan 30 prosenttia tulijoista. Toivon mukaan harmonisoidumman turvapaikkajärjestelmän myötä ne jäsenmaat, jotka eivät nykyään kanna vastuutaan, tekevät sen, sanoo maahanmuuttoministerin poliittinen neuvonantaja Andreas Ollinen.

Turvapaikanhakijoiden reilumpi jakaminen on asia, josta maahanmuuttoministeri Tobias Billström on puhunut usein. Jos muut maat ottaisivat enemmän, voisi se tarkoittaa, että harvempi hakisi turvapaikkaa Ruotsista. Mutta Andreas Ollinen ei myönnä, että se olisi tavoite.
– Ei voi sanoa, että Ruotsi tekee liikaa, vaan että muut tekevät liian vähän.

[...]  (käännös)
Sveriges Radio: EU-länderna överens om gemensam asylpolitik (http://sverigesradio.se/sida/gruppsida.aspx?programid=3993&grupp=18785&artikel=5494765) 4.4.2013
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 12.04.2013, 15:47:55
Lainaus
Toivon mukaan harmonisoidumman turvapaikkajärjestelmän myötä ne jäsenmaat, jotka eivät nykyään kanna vastuutaan, tekevät sen, sanoo maahanmuuttoministerin poliittinen neuvonantaja Andreas Ollinen.

Mikä helevatun vastuu?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.05.2013, 13:02:05
CEASin suunnittelun historiaa ja kirjoittamisen (2007) aikaista kuvausta:
Lainaus
Sidorenko analyses and evaluates the state of affairs of the Common European Asylum System (CEAS). The conclusions of the European Council meeting of Tampere are taken as a 'measuring instrument' to assess the current developments of the CEAS. The implementation in practice of the EU asylum legislation is also evaluated. For this purpose, the implications of the CEAS at a national level in an EU Member State are analysed. Slovakia, a new Member State, was chosen as an example due to its geographical location at the EU external border and the high number of asylum applicants present in this country. By examining EU and national asylum law against the background of international law (the 1951 Geneva Convention Relating to the Status of Refugees), a well-balanced critique of the CEAS is offered which provides views and expectations concerning its future direction.
Sidorenko: The Common European Asylum System: Background, Current State of Affairs, Future Direction (http://www.temaasyl.se/Documents/Forskning/Forskningsstudier/Sidorenko%20avhandling%20CEAS%20&%20Slovakien%202007.pdf) (pdf)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tommi Korhonen - 05.05.2013, 23:03:12
Lainaus
Toivon mukaan harmonisoidumman turvapaikkajärjestelmän myötä ne jäsenmaat, jotka eivät nykyään kanna vastuutaan, tekevät sen, sanoo maahanmuuttoministerin poliittinen neuvonantaja Andreas Ollinen.

Mikä helevatun vastuu?

Periaatteessa kai suvereeni Ruotsin kaltainen maa saa ottaa vastuukseen hoitaa asioita. Pitäkööt kivaa sen kanssa, tai kuten englanniksi sanotaan: knock yourselves out. Luonnollisesti heillä ei ole oikeutta yrittää siirtää tuota vastuuta kenellekään kolmannelle osapuolelle.
Pelottavaa on jos mokuttajat pystyvät ottamaan saman vastuun EU:n puolesta, tällöin vastuu syntyy - lainopillisesti. On hurjan pelottavaa että pienissä piireissä, luultavasti enintään vain muutamien tuhansien henkilöiden joukossa, voidaan päättää tuollaisesta asiasta joka sitoo satoja miljoonia EU-kansalaisia. Tosin oletan että 22 maan esimerkki saattaa johtaa päätöksen joutumiseen vastatuuleen. Tai jopa koko EU:n. Tosin eipä nuiva tiedostaminen (siinä määrin kuin sitä voidaan terveen kansallisen itsekkyyden nimissä puhua) ole kovin korkeassa kurssissa vielä toistaiseksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Benjamin - 17.05.2013, 13:22:01
Aftonbladet 2013-05-17 / Käännös by Google:

Yhteinen turvapaikkapolitiikka EU

EU: lla on yhteinen pakolaispolitiikka kesäkuussa. Ruotsissa, on todennäköistä, että saamme pienen osan pakolaisista, sanoo EU-komissaari Cecilia Malmström ruotsalaisen sanomalehden Svenska Dagbladet.

Uudistuksen tavoitteena on nostaa standardeja pakolaisten suojelun Euroopassa, mutta se vie aikaa saada prosessi alkoi, sanoo Malmö Virta.

- Toivottavasti se on yhtä tasaisempi vastaanoton Euroopassa. Tänään on viisi, kuusi maata, jotka saavat suurimman osan pakolaisista, hän kertoo lehden.

http://www.aftonbladet.se/nyheter/article16789308.ab
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Shemeikka - 17.05.2013, 13:54:33
Käännös by (Uhtuan) Shemeikka:

Lainaus
EU:LLE YHTEINEN PAKOLAISPOLITIIKKA

EU saa yhteisen pakolaispolitiikan kesäkuussa. Ruotsille se merkinnee että otamme vastaan pienemmän osan pakolaisista, sanoo EU-komissaari Cecilia Malmströn Svenska Dagbladetille.
Muutoksen tarkoituksena on parantaa pakolaisten vastaanoton laatua Euroopassa, mutta vie aikaa saada muutos käyntiin, kertoo Malmström.

- Toivottavasti pakolaisia tullaan vastaanottamaan tasaisemmin Euroopassa. Nyt viisi tai kuusi maata ottavat vastaan lähes kaikki pakolaiset, sanoo Malmström lehdelle.

Ne jotka ottavat nyt vähemmän turvapaikanhakijoita tulevat saamaan enemmän ja jotka nyt ottavat enemmän pakolaisia, ottavat tulevaisuudessa vastaan vähemmän. Kakka vähenee levittämällä...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 17.05.2013, 14:01:43
Lainaus
Ne jotka ottavat nyt vähemmän turvapaikanhakijoita tulevat saamaan enemmän ja jotka nyt ottavat enemmän pakolaisia, ottavat tulevaisuudessa vastaan vähemmän. Kakka vähenee levittämällä...

Missäs taas olikaan se "purkkapallo-video", jossa havainnollistettiin se, että otettiin tulijoita miten paljon tahansa, ne eivät lopu milloinkaan suuren syntyvyyden vuoksi..
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 18.05.2013, 15:27:05
Lainaus
Ne jotka ottavat nyt vähemmän turvapaikanhakijoita tulevat saamaan enemmän ja jotka nyt ottavat enemmän pakolaisia, ottavat tulevaisuudessa vastaan vähemmän. Kakka vähenee levittämällä...

Missäs taas olikaan se "purkkapallo-video", jossa havainnollistettiin se, että otettiin tulijoita miten paljon tahansa, ne eivät lopu milloinkaan suuren syntyvyyden vuoksi..

Originaali ja selkein sigussani.

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.05.2013, 19:03:09
Aftonbladet 2013-05-17 / Käännös by Google:

Yhteinen turvapaikkapolitiikka EU

EU: lla on yhteinen pakolaispolitiikka kesäkuussa.

Ei ole likimainkaan yhteistä pakolaispolitiikkaa kesäkuussa vaan yhteisen turvapaikkajärjestelmän (CEAS) ensiaskel.

Lainaus
Ruotsissa, on todennäköistä, että saamme pienen osan pakolaisista, sanoo EU-komissaari Cecilia Malmström ruotsalaisen sanomalehden Svenska Dagbladet.

Ruotsi saa vähintään saman osan ja joka tapauksessa määrällisesti enemmän pakolaisia, jos se ei tiukenna pakolaispolitiikkaansa. EU ei pakota Ruotsia tiukentamaan sitä, eivätkä muut maat aio apinoida Ruotsia. 

Lainaus
Uudistuksen tavoitteena on nostaa standardeja pakolaisten suojelun Euroopassa...

Tarkoittaa vain sitä, että läpikulkuvaltioissakaan ei tarvitse pelätä entisenlaista huonoa kohtelua ja käännytyksiä, joten ihmissalakuljetus on entistä tuottoisampaa. Esimerkiksi Italiaanhan ei jätetä palauttamatta Dublin-tapauksia siksi, että sieltä ei saisi turvapaikkaa, vaan siksi, että siellä ei jaella pohjoismaista sosiaaliturvaa. Tähän ei taatusti ole tulossa muutosta.

Lainaus
- Toivottavasti se on yhtä tasaisempi vastaanoton Euroopassa. Tänään on viisi, kuusi maata, jotka saavat suurimman osan pakolaisista, hän kertoo lehden.

Mikään ei viittaa siihen, että tunku päävastaanottajamaihin vähenisi himpun vertaa. Uudet säännöt vain esimerkiksi murentavat entisestään Dublin-sopimusta.

Tässä Malmströmin valehtelu alkuperäisenä:
Lainaus
Sverige kommer att ta emot en mindre del av den europeiska flyktingströmmen när EU får en gemensam asylpolitik. Den bedömningen gör EU-kommissionär Cecilia Malmström.

Den svenska EU-kommissionären Cecilia Malmström vänder sig till sina medarbetare.

– Hur många tar Estland? Femton, tjugo? Estland gav asyl till tjugo flyktingar förra året!

I Sverige biföll Migrationsverket drygt 12 000 asylansökningar i fjol och Sverige var trea på EU-topplistan över antal asylsökande. Bara till EU-jättarna Tyskland och Frankrike kom det fler för att be om skydd.

I juni, efter fjorton års malande i Bryssels jättekvarn, blir EU:s gemensamma asylpolitik slutligen antagen i juni.

Sverige hör i dag alltså till den lilla grupp länder som tar emot nästan alla flyktingar, men det relativa trycket kommer att minska efter EU-reformen.

– Ja, jag tror att det kommer att bli så, säger den svenska EU-kommissionären Cecilia Malmström.

INBÖRDESKRIGET I SYRIEN Flyktingar på väg till Sverige

Hon är ansvarig för flyktingfrågorna i EU-kommissionen, och har lotsat asylpaketet förbi flera ibland motvilliga regeringar i EU:s huvudstäder.

Malmström beskriver reformen som historisk och den syftar till att höja standarden i flyktingmottagandet i Europa. De stora skillnaderna som finns i dag - både i chansen att beviljas asyl och villkoren för de asylsökande – ska försvinna.

– Förhoppningsvis blir det då ett jämnare mottagande i Europa, i dag är det 5-6 länder som tar emot nästan alla flyktingar.

När fler länder blir bättre på flyktingmottagande betyder det enligt Cecilia Malmström också att Sverige i högre grad kommer att kunna tillämpa Dublinförordningen, alltså att asyl ska prövas i det första EU-land en flyende kommer till.

– Vi har många fall där folk har kommit till Sverige, efter att ha varit i ett annat land först. Men vi har inte skickat tillbaka dem för att villkoren är så usla där, säger hon och pekar på Cypern, Malta, Italien och Grekland som problemländer.

GREKLANDKRISEN Tufft asylläge

Den dämpande effekten på den svenska mottagandet är inget Cecilia Malmström marknadsför när hon talar om reformen. Det gör inte politiker hemma i Sverige heller, ämnet är politiskt laddat.

Migrationsminister Tobias Billström talade i vintras om att minska ”volymerna” av asylsökande men det var efter ett annat uttalande - det om ”blonda och blåögda” - som han läxades upp offentligt av statsministern.

Om Malmström har rätt, och fler asylsökande söker sig till andra EU-länder, skulle det alltså vara en svensk liberal i Bryssel som dämpar asyltrycket på Sverige.

Det vore i såfall en politisk ironi, för Cecilia Malmströms mål har aldrig varit att Sverige ska ta emot färre flyktingar. Visionen är snarare den här:

– Med det nya asylsystemet på plats kan EU som helhet kanske ta emot fler flyktingar.

[...]

Cecilia Malmström pekar på färska framgångar för de nationalistiska EU-motståndarna i UK Independence Party i Storbritannien, och oroas av att Sverigedemokraterna kan vinna framgång i EU-valet.

– Risken är att missnöjet med EU utnyttjas av väldigt populistiska och EU-skeptiska partier. Slår liknande partier igenom i flera länder kan de få väldigt stort inflytande.

Malmström ryser vid tanken på högerpopulistiska EU-motståndare som maktfaktor i parlamentet. Hon ser en fara i att de etablerade partierna i Sverige anpassar sig till den EU-skeptiska opinionen, i stället för att argumentera för EU.

– Då riskerar vi att få ett EU-parlament med en stor grupp som egentligen vill upplösa samarbetet.
Svd: Minskat asyltryck på Sverige (http://www.svd.se/nyheter/inrikes/minskat-asyltryck-pa-sverige_8178896.svd) 17.5.2013

Malmströmkin myöntää, että CEAS johtaa turvapaikanhakijamäärien kasvuun.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 10.06.2013, 13:03:54
Lainaus
Tällä viikolla Euroopan parlamentissa

Kesäkuun täysistunto (10.-13.6.): turvapaikkajärjestelmä, Schengen, terveysuhat ja eurovaalit

Parlamentti äänestää yhteisestä eurooppalaisesta turvapaikkajärjestelmästä

Parlamentti äänestää keskiviikkona yhteisestä eurooppalaisesta turvapaikkajärjestelmästä. Järjestelmä pitää sisällään yhteisiä sääntöjä turvapaikkahakemusten käsittelylle ja käsittelyajoille sekä määrittää unioniin saapuvien turvapaikanhakijoiden oikeuksia. Lisäksi järjestelmä pyrkii estämään turvapaikanhakijoiden siirron niihin EU-maihin, joilla on vaikeuksia hakemusten käsittelyssä. Vuoden 2012 aikana EU-maissa rekisteröitiin noin 330.000 turvapaikanhakijaa.
...

SDP (http://www.sdp.fi/fi/uutiset/13-eu/5525-talla-viikolla-euroopan-parlamentissa)

Keskustelut aiheesta tiistaina klo 15 alkaen (http://www.europarl.europa.eu/plenary/fi/home.html).


Lisäksi toinen maahanmuuttoon liittyvä aihe äänestettävänä:

Lainaus
Schengen: tarkastuskäyntejä rajanylityspaikoille

Keskiviikkona äänestettävän Schengenin uudistuspaketin mukaan Schengenin noudattamista valvovilla tarkastajilla olisi valtuudet tehdä tarkastuskäyntejä sisärajojen rajanylityspaikoille. Ennalta ilmoittamattomien tarkastuskäyntien tarkoitus on estää laittomat tarkastukset sisärajoilla. Tuoreen eurobarometritutkimuksen mukaan 62 % vastaajista piti vapaata liikkuvuutta kaikkein positiivisimpana Euroopan yhdentymisen seurauksena.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.06.2013, 17:56:50
Komissaari Malmströmin hellimä ajatus pysyvästä, vapaaehtoisuuteen perustuvasta järjestelmästä, jossa pakolaisia ja turvapaikanhakijoita siirrettäisiin jäsenmaasta toiseen, ei etene, koska sille ei ole nyt poliittista ilmastoa (http://www.europarl.europa.eu/sides/getDoc.do?type=CRE&reference=20130520&secondRef=ITEM-017&language=EN&ring=O-2013-000021). Malmström ei aio viedä asiaa eteenpäin, koska vain parin jäsenmaan sisäministerit kannattavat hanketta. Vastaavassa vapaaehtoisuuteen perustuvassa väliaikaisessa EUREMA-projektissa on kahden vuoden aikana siirretty peräti 14 ihmistä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 11.06.2013, 21:40:59
Täysistunnon puheenvuorot aiheesta:

http://www.europarl.europa.eu/ep-live/fi/plenary/video?debate=1370955781892 (http://www.europarl.europa.eu/ep-live/fi/plenary/video?debate=1370955781892)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 12.06.2013, 09:38:09
päivän paperi-Pravdassa oli kaksi sivua tästä aiheesta. Kerrottiin MEPpien äänestämisestä ja esiteltiin kaksi kuvaavaa turvapaikanhakijatapausta, molemmat ymmärtääkseni huijareita kun olivat tulleet Rotsiin ja Suomeen asti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 12.06.2013, 09:44:48
Komissaari Malmströmin hellimä ajatus pysyvästä, vapaaehtoisuuteen perustuvasta järjestelmästä, jossa pakolaisia ja turvapaikanhakijoita siirrettäisiin jäsenmaasta toiseen, ei etene, koska sille ei ole nyt poliittista ilmastoa (http://www.europarl.europa.eu/sides/getDoc.do?type=CRE&reference=20130520&secondRef=ITEM-017&language=EN&ring=O-2013-000021). Malmström ei aio viedä asiaa eteenpäin, koska vain parin jäsenmaan sisäministerit kannattavat hanketta.

 :-*  Ihanaa! Tästä ilmastonmuutoksesta minä pidän!  :-*
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: siviilitarkkailija - 12.06.2013, 10:06:06
Ehkä nämä rkp-spr vetoiset naispoliitikot nauttivat raiskauksista kun niiden uhriksi joutuvat jotkut muut kuin he itse. Mehän voimme poliittisen median näytösistunnoista havaita että nämä poliittisesti aktiivit naiset aktivoituvat valtaisasti kun heitä itseään väitetään uhakaillun. Mutta vastaavasti toisten naisten joutuessa ulkomaalaisten seksuaalirikollisten ja ulkomaalaisten ihmiskauppiaiden uhreiksi, näiden poliittisten itseriittoisten toimijoiden älämölö muuttuu hiljaiseksi hurinaksi ja sisäänpäinkääntyneeksi hymyilyksi.

On siis hieman rohkeaa väittää että ns rkp-spr tantat nauttivat hiljaisesti toisten joutuessa rikosuhriksi ja hyväksikäytön kohteeksi, mutta muuta selitystä näiden poliittisten toimijoijiden arvovalinnoille on vaikeaa löytää. Jostain syystä tämmöinen linja näyttää nauttivan pidäkkeetöntä kannatusta myös sanomamediassa. Se että miksi niin jääköön arvoitukseksi kuin sekin miksi minä edes mainitsen asiasta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Siili - 12.06.2013, 10:42:20
Komissaari Malmströmin hellimä ajatus pysyvästä, vapaaehtoisuuteen perustuvasta järjestelmästä, jossa pakolaisia ja turvapaikanhakijoita siirrettäisiin jäsenmaasta toiseen, ei etene, koska sille ei ole nyt poliittista ilmastoa (http://www.europarl.europa.eu/sides/getDoc.do?type=CRE&reference=20130520&secondRef=ITEM-017&language=EN&ring=O-2013-000021). Malmström ei aio viedä asiaa eteenpäin, koska vain parin jäsenmaan sisäministerit kannattavat hanketta. Vastaavassa vapaaehtoisuuteen perustuvassa väliaikaisessa EUREMA-projektissa on kahden vuoden aikana siirretty peräti 14 ihmistä.

Onko mahdollista, että komissaarit ovat kokouksessaan päättäneet, että EU-vaaleihin asti he pitävät kohtuullisen nöyrää julkisivua?  Liian innokas federalismin tuputtaminen saattaisi ensi kesänä tuottaa voimakkaan antifederalistisen reaktion.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 12.06.2013, 15:48:59
Lainaus
Europarlamentti tukee EU:n yhteistä turvapaikkajärjestelmää

Euroopan parlamentti hyväksyi keskiviikkona uudet säännöt turvapaikkahakemusten käsittelylle ja käsittelyajoille sekä vahvisti turvapaikanhakijoiden perusoikeuksia.

Yhteinen eurooppalainen turvapaikkajärjestelmä estää turvapaikanhakijoiden siirron niihin EU-maihin, jotka eivät voi taata hakijoille kohtuullisia elinolosuhteita.
...

Verkkouutiset (http://www.verkkouutiset.fi/politiikka/eu_turvapaikkajarjestelma_parlamentti-4665)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: nuiv-or - 12.06.2013, 19:04:48
Lainaus
Parliament gives green light to the new European asylum system

PLENARY SESSION  Asylum policy - 12-06-2013 - 13:39
 
New rules laying down common procedures and deadlines for handling asylum applications and basic rights for asylum seekers arriving in the EU were endorsed by Parliament on Wednesday. The Common European Asylum System will also stop transfers of asylum seekers to member states unable to ensure decent living conditions for them.



Common asylum procedures

Current EU law does not impose specific deadlines on member states for deciding on asylum applications. To iron out differences between national asylum procedures, the new rules bring in common deadlines for handling asylum applications (a standard six-month deadline with limited exceptions), stricter rules on training staff dealing with asylum seekers and new provisions for the special needs of unaccompanied minors and other vulnerable persons.


Minimum reception conditions

A shortlist of grounds for detaining asylum seekers, decent detention and living conditions, an early assessment of asylum seekers' medical and psychological needs and swifter access to the labour market (nine months after lodging an asylum application) are among the key improvements to the 2003 reception conditions directive. As a general rule, if asylum seekers are detained, they will have to be placed in specialised detention facilities.


No transfers to countries unable to cope

The Dublin regulation determines which country is responsible for dealing with an asylum request (usually the one through which the asylum seeker first entered the EU). Under the new rules, asylum seekers will not be transferred to EU countries where there is a risk of inhuman or degrading treatment. These rules will also introduce an early-warning mechanism to help tackle problems in national asylum systems before they turn into crises.


Police access to asylum seekers' database

Finally, member states’ police forces and Europol will have access to asylum seekers’ fingerprints in the Eurodac database, to help them fight terrorism and serious crime. At the request of MEPs, stricter data-protection provisions and new safeguards to ensure that data is not used for other purposes, will apply.


Next steps

The new asylum system updates laws passed about a decade ago. Some 330,000 asylum applicants were registered in EU countries in 2012.

The new asylum rules, which have already been agreed by Parliament and Council representatives and backed by national governments, should enter into force in the second half of 2015.

The Dublin rules on transfers of asylum seekers will take effect six months after their legal entry into force (i.e. at the start of 2014).


Procedure: Co-decision (Ordinary Legislative Procedure), 2nd reading agreement (reception conditions, procedures and Dublin II regulation) and co-decision (Ordinary Legislative Procedure), 1st reading agreement (Eurodac)



http://www.europarl.europa.eu/news/en/pressroom/content/20130607IPR11389/html/Parliament-gives-green-light-to-the-new-European-asylum-system


Keskustelun voi katsoa täältä: http://www.europarl.europa.eu/ep-live/en/plenary/video?debate=1370955781892 (http://www.europarl.europa.eu/ep-live/en/plenary/video?debate=1370955781892)

Jos mokuttajan puheenvuoro kiinnostaa, kuuntele punapaitaisen Franziska Kellerin ajatuksia kohdassa 1.02.30 - 1.04.45.


Europarlamentti on hullujenhuone.


2013-06-10 EP this week: asylum, border controls, situation in Turkey (http://hommaforum.org/index.php/topic,84229.msg1350076.html#msg1350076)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 23.07.2013, 01:33:02
Europarlamentaarikko Cecilia Wikström ehdottaa, että EU helpottaisi turvapaikanhakijoiden alueelleen saapumista myöntämällä heille viisumeita EU-lähetystöistä.

Linkin (http://sverigesradio.se/sida/artikel.aspx?programid=1650&artikel=5593412) takana Cecilia Wikströmin ja maahanmuuttokomissaari Cecilia Malmströmin keskustelevat ehdotuksesta Ruotsin radion viikon takaisessa haastattelussa. Malmström komppaa, mutta valittelee EU:n rasistisia puolueita ja talouskriisiä, jotka ovat muuttaneet poliittisen ilmaston hankalaksi. Malmström toteaa, että nykytilanteessa ehdotus joudutaan jättämään muutamaksi vuodeksi pöydälle, mutta sitten siihen palataan ja turvapaikanhakua helpotetaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: td - 23.07.2013, 01:53:02
Europarlamentaarikko Cecilia Wikström ehdottaa, että EU helpottaisi turvapaikanhakijoiden alueelleen saapumista myöntämällä heille viisumeita EU-lähetystöistä.

Linkin (http://sverigesradio.se/sida/artikel.aspx?programid=1650&artikel=5593412) takana Cecilia Wikströmin ja maahanmuuttokomissaari Cecilia Malmströmin keskustelevat ehdotuksesta Ruotsin radion viikon takaisessa haastattelussa. Malmström komppaa, mutta valittelee EU:n rasistisia puolueita ja talouskriisiä, jotka ovat muuttaneet poliittisen ilmaston hankalaksi. Malmström toteaa, että nykytilanteessa ehdotus joudutaan jättämään muutamaksi vuodeksi pöydälle, mutta sitten siihen palataan ja turvapaikanhakua helpotetaan.

No huh,

Onneksi on nämä "rasistiset" EU:n puolueet... ???

Lisää aikaa kansalle tuoda esille mielipiteensä...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 23.07.2013, 02:41:33
Onneksi on nämä "rasistiset" EU:n puolueet... ???

Nykyisin Malmströmin lempiselitys vähän kaikelle. "Kyllä minä muuten, mutta kun rasistipuolueita on enemmän kuin koskaan toisen maailmansodan jälkeen ja kohta ne valtaa europarlamentinkin":
Lainaus
Speaking to reporters in Lithuania’s capital Vilnius, EU home affairs commissioner Cecilia Malmstrom said the EU has never before seen so many far right parties in elected bodies since the Second World War.

“In many countries, xenophobia, populism, [and] racism is on the rise,” she said, noting such political parties will most likely be sending emissaries to the EU’s Brussels-based parliament next year.

“Some of these parties have existed for a long time in the European Union, some are quite new, some are very close to entering into government,” she said.

She described the growing phenomenon as counter productive for a struggling EU economy that is need of skilled workers currently not available in Europe, despite the high unemployment numbers.
EUObserver: Growing racism spurs rise in extremist parties, commission says (http://euobserver.com/justice/120905) 18.7.2013

Informal Meeting of Ministers for Justice and Home Affairs, 18 July. Press conference (http://www.youtube.com/watch?feature=player_detailpage&v=eCLeatUfN4c#t=1313s) (video)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 23.07.2013, 12:01:08
Onneksi näillä punavihersokeilla ruotsalaisvajakeilla on "lite kvar". Ensi vuoden EP-vaalien jälkeen vaihtuu komissiokin. Toivottavasti seuraava oikeus- ja sisäasiainkomissaari ei ole ruotsalainen tai esim. maltalainen ja toivottavasti hän edustaa näitä mainittuja "populistisia ja rasistisia" ryhmittymiä. Tämän luulisi olevan kaikkien tolkullista maahanmuuttopolitiikkaa ajavien euroryhmittymien tavoitteena seuraavan komission kokoonpanojuonitteluissa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.07.2013, 11:59:03
Lainaus
Today, the Dublin III Regulation enters into force. For the European Union and its member states, this is a pivotal moment because it heralds the arrival of what they consider to be the Common European Asylum System. It is also a pivotal moment for asylum seekers: the way in which EU member states implement Dublin III will undoubtedly impact their ability to seek protection in Europe.
Jesuit Refugee Service (JRS), the European Council on Refugees and Exiles (ECRE): The Dublin III Regulation enters into force (http://www.jrseurope.org/publications/ECREJRSStatementonDublinIII_publications_19072013.pdf) (pdf) 19.7.2013

It's alive! (http://www.youtube.com/watch?v=xos2MnVxe-c)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 03.08.2013, 23:48:11
Euroopan komissio ryhtyy järjestämään vuosittaista eurooppalaista (EU-maat, Norja, Sveitsi, Islanti, Liechtenstein) foorumia, jonka aiheena on suojelun tarpeessa olevien uudelleensijoitus. Tarkoitus on edistää turvapaikanhakijoiden uudelleensijoittamista Euroopan maasta toiseen. Etenkin Malta on ollut viime aikoina vaikeuksissa turvapaikanhakijavyöryn kanssa, mutta muut maat eivät ole innostuneet ottamaan vapaaehtoisesti vastaan Maltan turvapaikanhakijoita. Komission mukaan turvapaikanhakijoiden uudelleensijoitus on yksi konkreettisimmista tarjolla olevista solidaarisuuden muodoista, joilla jäsenmaat voivat helpottaa toisen jäsenmaan vastaanottojärjestelmän paineita.

Uudelleensijoituksen suosiota toivottavasti lisää EU:n uusi turvapaikka- ja maahanmuuttorahasto, joka ryhtyy ensi vuonna maksamaan vastaanottaville maille könttäkorvauksen jokaisesta siirretystä turvapaikanhakijasta. Rahaston maksamat korvaukset tulevat olemaan moninkertaisia monien maiden (ei toki Suomen) vastaanottokuluihin verrattuna. Ensin jäsenmailta täytyy tosin kerätä rahastoon miljardi euroa kahden ensimmäisen vuoden toiminnan kulujen kattamiseksi.

Malta Today: Commission proposes forum to consider relocation of beneficiaries of international protection (http://m.maltatoday.com.mt/newsdetails/news/national/Commission-proposes-forum-to-consider-relocation-of-beneficiaries-of-international-protection-20130731) 1.8.2013
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: gloaming - 04.08.2013, 09:06:02
"Uudelleensijoittaminen" pitäisi toteuttaa kuten Australiassa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: veikko1980 - 04.08.2013, 09:29:53
Euroopan komissio ryhtyy järjestämään vuosittaista eurooppalaista (EU-maat, Norja, Sveitsi, Islanti, Liechtenstein) foorumia, jonka aiheena on suojelun tarpeessa olevien uudelleensijoitus. Tarkoitus on edistää turvapaikanhakijoiden uudelleensijoittamista Euroopan maasta toiseen. Etenkin Malta on ollut viime aikoina vaikeuksissa turvapaikanhakijavyöryn kanssa, mutta muut maat eivät ole innostuneet ottamaan vapaaehtoisesti vastaan Maltan turvapaikanhakijoita. Komission mukaan turvapaikanhakijoiden uudelleensijoitus on yksi konkreettisimmista tarjolla olevista solidaarisuuden muodoista, joilla jäsenmaat voivat helpottaa toisen jäsenmaan vastaanottojärjestelmän paineita.

Uudelleensijoituksen suosiota toivottavasti lisää EU:n uusi turvapaikka- ja maahanmuuttorahasto, joka ryhtyy ensi vuonna maksamaan vastaanottaville maille könttäkorvauksen jokaisesta siirretystä turvapaikanhakijasta. Rahaston maksamat korvaukset tulevat olemaan moninkertaisia monien maiden (ei toki Suomen) vastaanottokuluihin verrattuna. Ensin jäsenmailta täytyy tosin kerätä rahastoon miljardi euroa kahden ensimmäisen vuoden toiminnan kulujen kattamiseksi.

Malta Today: Commission proposes forum to consider relocation of beneficiaries of international protection (http://m.maltatoday.com.mt/newsdetails/news/national/Commission-proposes-forum-to-consider-relocation-of-beneficiaries-of-international-protection-20130731) 1.8.2013

missä tarvitaan väkeä?

-baltian maat
-unkari
-bulgaria

Mainitut maat eivät halua pakolaisia ja moni on ilmoittanut tämän julkisestikin
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 04.08.2013, 09:46:50
-baltian maat
-unkari
-bulgaria

Mainitut maat eivät halua pakolaisia ja moni on ilmoittanut tämän julkisestikin

Juuri siksi tuo uusi rahasto. Eiväthän suomalaiset kunnatkaan halua pakolaisia, mutta ottavat silti, kun rahaa tyrkytetään.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: orientexpressen - 04.08.2013, 12:27:15
Suomi voisi aloittaa oma-aloitteisesti Euroopan laajuisen taakanjaon sopimalla turvapaikanhakijoiden uudelleensijoittelusta esimerkiksi Moldovan tai Valko-Venäjän kanssa. Turvapaikanhakijoille ja humanitaarisille maahanmuuttajille pystyttäisiin luultavasti järjestämään elanto näissä maissa esimerkiksi kolhoosin maatyöläisinä.

Tämänkaltaisesta aloitteellisuudesta tulisi epäilemättä runsaasti suvaitsevaisuuspisteitä Cecilia Malmströmiltä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 25.08.2013, 13:10:25
Lainaus
EU:lta puuttuu maahanmuuttolinja

Jäsenmaiden yhteistyö ei ole kehittynyt juuri rajavartiointia pidemmälle

Viime vuosina iso osa paperittomista maahanmuuttajista on saapunut Eurooppaan kriisimaa Kreikan kautta. Paine on hellittänyt, mutta ongelma odottaa yhä ratkaisua.

Euroopan talouskriisin rinnalle on syntynyt sosiaalinen kriisi, josta voi osin syyttää EU:n epäonnistunutta maahanmuuttopolitiikkaa. Näin väittää Euroopan neuvoston ihmisoikeusvaltuutettu Nils Muižnieks.

"Ankarat säästötoimet johtivat maahanmuuttokeskustelun kovenemiseen. Rasistiset hyökkäykset ovat lisääntyneet, mutta vain tietyissä maissa, kuten Kreikassa."
...

Kreikassa sitä vastoin ei ole vieläkään kunnollista maahanmuuttopolitiikkaa, vaikka EU onkin korvamerkinnyt Kreikalle resursseja maahanmuuton ongelmiin.

"Kysymys kuuluu: Voiko EU ostaa yksittäisiltä mailta maahanmuuton ratkaisuja vai pitäisikö sosiaalinen taakka jakaa tasaisesti kaikkien maiden kesken?" Collett heittää.

Vuonna 2011 Euroopan ihmisoikeustuomioistuin kielsi Belgiaa käännyttämästä turvapaikanhakijoita Kreikkaan. Tuomio lopetti käännytykset Kreikkaan myös muissa EU-maissa ja käytännössä mitätöi Dublin II -asetuksen. Asetuksen mukaan turvapaikkahakemus käsitellään pääasiassa siinä maassa, johon hakija ensimmäisenä saapuu.

Suomen kaltaisiin syrjäisiin maihin päätyy vain murto-osa paperittomista maahanmuuttajista. Välimeren maat, kuten Kreikka, Italia ja Malta, sitä vastoin käsittelevät valtavat määrät turvapaikkahakemuksia.

"Kun muut maat eivät voineet enää käännyttää ihmisiä Kreikkaan, paperittomien maahanmuutosta tuli kertaheitolla kaikkien sopimusmaiden pulma. Vastaukseksi on ehdotettu ongelmamaiden, kuten Kreikan, väliaikaista sulkemista Schengen-alueen ulkopuolelle. Se ei ratkaise ongelmaa, vaan siirtää sitä", Collett toteaa.

Dublin-järjestelmän uudistaminen olisi Collettin mielestä hyvä sauma edistää yhteistä maahanmuuttopolitiikkaa. Maahanmuuttajiin ei kuulu vain turvapaikanhakijoita, vaan myös työn perässä muuttavia ihmisiä. Eurooppa ikääntyy vauhdilla. Joillain alueilla, kuten Pohjois-Espanjassa ja Itä-Saksassa, tilanne on jo akuutti.
...

Pelkkä maahanmuuttopolitiikan harmonisointi ei Collettin mukaan riitä: "Sosiaaliturvan ja työmarkkinoiden samankaltaisuus edistää työvoiman tasapuolista liikkuvuutta. Luxemburgissa palkat ovat kymmenen kertaa suuremmat kuin Romaniassa."

Myös Laitinen korostaa kokonaisvaltaisen maahanmuuttopolitiikan tärkeyttä.

"200 000 laittomasti tulevaa kohti on muutama kymmenen miljoonaa laillisesti Eurooppaan saapuvaa maahanmuuttajaa."

Artikkeli kokonaisuudessaan: Helsingin Sanomat (http://www.hs.fi/kotimaa/EUlta+puuttuu+maahanmuuttolinja/a1377318974282?ref=hs-art-new-2)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 25.08.2013, 15:54:07
EU:lta puuttuu maahanmuuttolinja

Lainaus käyttäjältä: HS 25.8.2013
Euroopan talouskriisin rinnalle on syntynyt sosiaalinen kriisi, josta voi osin syyttää EU:n epäonnistunutta maahanmuuttopolitiikkaa. Näin väit­tää Euroopan neuvoston ihmisoikeusvaltuutettu Nils Muižnieks.

"Ankarat säästötoimet johtivat maahanmuuttokeskustelun kovenemi­seen. Rasistiset hyökkäykset ovat lisääntyneet, mutta vain tietyissä mais­sa, kuten Kreikassa."

Ongelma ei ole keskustelussa vaan siinä, että sekä ulko- että sisärajojen valvonta ei toimi, eikä laittomia siirtolaisia poisteta EU-alueelta. Tämä vaikuttaa tarkoitukselliselta politiikalta.

Lainaus käyttäjältä: HS 25.8.2013
Viime vuosina noin puolet paperittomien maahanmuuttajien rajanylityk­sistä Schengen-alueelle on tapahtunut Turkin ja Kreikan rajalla.

"Kun yli 50 000 paperitonta maahanmuuttajaa pyrkii Eurooppaan yh­den maan kautta, on turha ihmetellä Kreikan poliittista levottomuutta. Taakkaa ei ole jaettu EU:ssa reilusti, ja äärioikeistoa on ruokittu bensal­la."

Hesarin jutussa puhutaan "Euroopan paperittomista maahanmuuttajista", mutta luvut viittaavat ilmeisesti sellaisiin laittomiin siirtolaisiin, jotka ovat jääneet kiinni ja joiden kiinnijääminen on rekisteröity. Laittomien siirtolaisten kokonaismäärä - jo pelkkien turvapaikanhakijoidenkin määrä -  on moninkertainen.

"Taakkaa" ei ole mitään mieltä "jakaa", vaan EU:n pitäisi viimeinkin ryhtyä toimiin, joilla "taakan" saapumista ja jäämistä EU-alueelle hillittäisiin.

Lainaus käyttäjältä: HS 25.8.2013
"Kreikan ja Turkin raja oli hot spot, mutta viime vuoden elokuussa kiris­tynyt valvonta ja yhteistyö Turkin kanssa aiheuttivat erittäin voimak­kaan muutoksen. Laittomien ylitysten määrä EU-rajoilla romahti viime vuonna puoleen ennätysvuodesta 2011, mutta painetta kertyy jatkuvas­ti", Laitinen sanoo.

"Yleensä rajanylitykset vain siirtyvät toiseen paikkaan, kuten keskiselle Välimerelle."

Eivät siirry samassa mitassa, vaan maarajojen valvonnan tehostaminen nostaa ihmissalakuljetuksen kustannuksia ja kynnystä, ja vähentää tulijamäärää. Frontexia johtava Laitinen tietää tämän hyvin esimerkiksi Frontexin raporteista. Lisäksi keskisen Välimeren kautta veneillä saapuvat ovat paremmassa kontrollissa kuin Kreikan rajan yli EU-alueelle hiippailevat.

Lainaus käyttäjältä: HS 25.8.2013
Maahanmuuttopolitiikan tutkimuslaitoksen MPI:n Euroopan toimiston johtaja Elizabeth Collett kertoo, että Espanja on esimerkki maasta, jos­sa kansalliset ratkaisut toimivat kelvollisesti. Espanjan massatyöttö­myys ei ole aiheuttanut voimakasta rasistista reaktiota.

Espanja on Italian ja Kreikan ohella esimerkki maasta, joka siirtää turvapaikanhakijat muun Euroopan niskoille. Sijainnistaan huolimatta Espanjaan on sikäläisten tilastojen mukaan saapunut viime vuosina muka vähemmän turvapaikanhakijoita kuin Suomeen. "Kansallinen ratkaisu" näkyy toimivan "kelvollisesti".

Lainaus käyttäjältä: HS 25.8.2013
"Kysymys kuuluu: Voiko EU ostaa yksittäisiltä mailta maahanmuuton ratkaisuja vai pitäisikö sosiaalinen taakka jakaa tasaisesti kaikkien mai­den kesken?" Collett heittää.

Mikä "sosiaalinen taakka" ja mikä "tasainen jakaminen kaikkien maiden kesken"? On kyse kunkin maan maahanmuuttopolitiikan valinnoista, joihin liittyy olennaisesti EU:n sisäisen vapaan liikkuvuuden ideaali, joka on haittamaahanmuuton myötä käytännössä kääntynyt EU-maiden edun vastaiseksi.

Lainaus käyttäjältä: HS 25.8.2013
Suomen kaltaisiin syrjäisiin maihin päätyy vain murto-osa paperitto­mista maahanmuuttajista. Välimeren maat, kuten Kreikka, Italia ja Mal­ta, sitä vastoin käsittelevät valtavat määrät turvapaikkahakemuksia.

No niinpä käsittelevät. Italia myöntää hakijoille oleskelulupia liukuhihnalta, mutta ei sosiaaliturvaa, joten matka jatkuu joko Suomen kaltaisiin sosiaaliturvamaihin tai harmaan talouden piiriin Keski-Eurooppaan ja Isoon-Britanniaan.

Lainaus käyttäjältä: HS 25.8.2013
"Kun muut maat eivät voineet enää käännyttää ihmisiä Kreikkaan, pape­rittomien maahanmuutosta tuli kertaheitolla kaikkien sopimusmaiden pulma. Vastaukseksi on ehdotettu ongelmamaiden, kuten Kreikan, väli­aikaista sulkemista Schengen-alueen ulkopuolelle. Se ei ratkaise ongel­maa, vaan siirtää sitä", Collett toteaa.

"Paperittomat" eivät ole synonyymi Dublin-käännytettäville turvapaikanhakijoille. "Paperittomilla" tarkoitetaan etenkin maassa laittomasti oleskelevia hylättyjä turvapaikanhakijoita, joten siinä mielessä "paperittomien" Schengen-alueelle pääsemisen estäminen olisi hyvin pitkälle ongelman ratkaisu, mutta valitettavasti pelkkä Schengen-alueen uudelleenmäärittely ei tosiaankaan ratkaise tätä ongelmaa.

Lainaus käyttäjältä: HS 25.8.2013
Dublin-järjestelmän uudistaminen olisi Collettin mielestä hyvä sauma edistää yhteistä maahanmuuttopolitiikkaa. Maahanmuuttajiin ei kuulu vain turvapaikanhakijoita, vaan myös työn perässä muuttavia ihmisiä. Eurooppa ikääntyy vauhdilla. Joillain alueilla, kuten Pohjois-Espanjassa ja Itä-Saksassa, tilanne on jo akuutti.

"Maahanmuutolla voidaan lievittää väestörakenteen jyrkkää muutosta. Kasvavien elinkustannusten Eurooppa ei ole ymmärtänyt, ettei tänne välttämättä haluta tulla. Esimerkiksi rahoituksen ja teknologian ammat­tilaisille löytyy Aasiasta houkuttelevia työpaikkoja."

Eli miten "yhteistä maahanmuuttopolitiikkaa" pitäisi työperäisen maahanmuuton nimissä "edistää", ja miten se liittyy turvapaikanhakijoihin? Kunkin maan intressit ovat erilaiset, joten kukin maa päättäköön mieleisestään maahanmuuttopolitiikasta ja väestörakenteesta itse omilla valinnoillaan.

Lisäksi maahanmuutolla ei voida merkittävästi vaikuttaa väestörakenteen muutoksen kielteisiin vaikutuksiin. Eurooppa ei vero- ym. ratkaisujensa vuoksi pärjää kilpailussa harvalukuisista osaajista, ja ei-osaajien massamaahanmuutto luo paljon enemmän ongelmia kuin ratkaisee. Ei ole esitetty sellaista "yhteistä maahanmuuttopolitiikkaa", joka muuttaisi tämän. Päinvastoin. On perustettu EU:n yhteinen turvapaikkajärjestelmä CEAS, joka tulee lisäämään EU-alueelle suuntautuvaa humanitaarista maahanmuuttoa ja siten huonontamaan EU-maiden taloudellista huoltosuhdetta.

Lainaus käyttäjältä: HS 25.8.2013
Pelkkä maahanmuuttopolitiikan harmonisointi ei Collettin mukaan rii­tä: "Sosiaaliturvan ja työmarkkinoiden samankaltaisuus edistää työvoi­man tasapuolista liikkuvuutta. Luxemburgissa palkat ovat kymmenen kertaa suuremmat kuin Romaniassa."

Sama palkka ja sama sosiaaliturva Luxemburgissa ja Romaniassa? En ymmärrä, miten se voisi toteutua lähitulevaisuudessa ilman jäsenmaiden suvereniteetin murtamista ja massiivisia tulonsiirtoja EU-maiden välillä. Ei kiitos, Suomi pärjää paremmin ilman tällaista.

Lainaus käyttäjältä: HS 25.8.2013
Myös Laitinen korostaa kokonaisvaltaisen maahanmuuttopolitiikan tär­keyttä.

"200 000 laittomasti tulevaa kohti on muutama kymmenen miljoonaa laillisesti Eurooppaan saapuvaa maahanmuuttajaa."

Mitä ihmeen "kokonaisvaltaista maahanmuuttopolitiikkaa" tässä tarvitaan? Suomen intresseissä on tiukentaa EU:n sisä- ja ulkorajojen valvontaa sekä helpottaa käännytyksiä ja karkotuksia, mahdollisesti EU:n laajuisen yhteistyön kautta, mutta toisaalta pitää Suomeen kohdistuva maahanmuutto ja oleskelulupien myöntäminen mahdollisimman pitkälle omissa näpeissä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.09.2013, 01:38:53
Lainaus
Building the Common European Asylum System: What Ambition? What Reality?

Presented by Judith Kunim, former UNHCR Director of Europe Operations, at the Canada Refugee Resettlement: Research and Innovation for the 21st Century conference in Vancouver, June, 2012.
YouTube (http://www.youtube.com/watch?v=L_Cthb21UpU) (52 min)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.09.2013, 13:17:38
Maahanmuuttokomissaari Malmström muistuttaa taas, mistä CEAS-hankkeessa on alusta asti ollut kysymys. Turvapaikanhakijoiden uudelleensijoituksesta jäsenmaista toisiin pakollisten maakohtaisten solidaarisuuskiintiöiden perusteella.

Lainaus
Turvapaikanhakijoiden uudelleensijoitus on parhaillaan keskustelunaiheena Euroopassa ja komissaari Malmström kiteytti näkemykset: Euroopan parlamentti vaatii pakollista uudelleensijoitusta ja pakolaiskiintiöitä, joiden kautta vastuuta jaettaisiin EU:ssa tasaisemmin. Jotkut jäsenmaat vastustavat uudelleensijoitusta, koska niiden mielestä se on pakolaisia houkutteleva vetotekijä, ja ehkäisee muita jäsenmaita parantamasta turvapaikanhakijoiden vastaanottojärjestelmänsä laatua. Useimpien maiden mielestä se voi olla tärkeä solidaarisuuden väline, mutta ei pakollinen.

"Meidän on kuitenkin ryhdyttävä kuvastamaan enemmän, mitä me todella tarkoitamme solidaarisuudella ja Euroopan yhteisellä turvapaikkajärjestelmällä", sanoi Malmström.

EU ei halua luoda vetotekijöitä eikä se halua houkutella ihmisiä turhille vaarallisille matkoille Saharan ja Välimeren yli.

"Mutta meidän ei pitäisi kieltäytyä osoittamasta solidaarisuutta toiselle EU-jäsenmaalle, koska päätämme, että uudelleensijoitus on vetotekijä, kun meillä ei ole mitään todisteita sellaisen väitteen perusteeksi", hän sanoi.  (käännös)
New Europe: EU needs to reflect on relocation (http://www.neurope.eu/article/eu-needs-reflect-relocation) 25.9.2013

Malmströmin puhe kokonaisuudessaan:
Intervention by Cecilia Malmström during the Relocation Forum (http://europa.eu/rapid/press-release_SPEECH-13-754_en.htm) 25.9.2013
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 30.09.2013, 13:29:04
^ Eli ymmärränkö oikein, että Ruotsi suunnittelee jatkossa kippaavansa roskansa rikkautensa mm. Suomeen vedoten turvapaikanhakijoiden uudelleensijoitukseen jäsenmaasta toiseen pakollisten maakohtaisten solidaarisuuskiintiöiden perusteella?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.09.2013, 13:52:09
^ Eli ymmärränkö oikein, että Ruotsi suunnittelee jatkossa kippaavansa roskansa rikkautensa mm. Suomeen vedoten turvapaikanhakijoiden uudelleensijoitukseen jäsenmaasta toiseen pakollisten maakohtaisten solidaarisuuskiintiöiden perusteella?

Komissaari edustaa EU:ta, ei Ruotsia. EU:n laskukaavat eivät lupaisi Ruotsille kovinkaan suurta helpotusta edes silloin, jos turvapaikanhakijoiden liikuttaminen olisi nollasummapeliä. Suuret siirrot vähemmän suosituista reunavaltioista ja kaikille samat oleskelulupaperusteet kuitenkin tarkoittaisivat sitä, että turvapaikanhakijoiden kokonaismäärä Euroopassa kasvaisi voimakkaasti.

Ruotsi tuskin hyötyisi siirroista, koska sehän edellyttäisi, että Ruotsi ryhtyisi voimakkaasti tehostamaan laittomien siirtolaisten poistamista alueeltaan. Muuten siirrettävät vain painuisivat maan alle ja nauttisivat Ruotsin laittomille siirtolaisille tarjoamista palveluista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 26.10.2013, 20:59:32
Päivän paperi-Pravdassa oli juttu, jossa kerrottiin taas ongitun 700 eurooppaanpyrkijää. Mielenkiintoista tämän ketjun kannalta jutussa oli se, että siinä kerrottiin Italian pääministerin hehkuttaneen ujuttaneensa EU:n äsken päättyneen huippukokouksen päätelmiin maininnan EU-solidaariuudesta. Ja että Välimeren yli pyrkivien turvapaikanhakijoiden hoito on koko Euroopan asia tai jotain. Eli poliittinen paine alkaa taas nousta...   
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Uuno Nuivanen - 26.10.2013, 21:01:16
Hyllyt täyteen! Meillä on varaa!  :)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 26.10.2013, 21:24:08
Mielenkiintoista tämän ketjun kannalta jutussa oli se, että siinä kerrottiin Italian pääministerin hehkuttaneen ujuttaneensa EU:n äsken päättyneen huippukokouksen päätelmiin maininnan EU-solidaariuudesta.

Lainaus
Etelä-Euroopan maat saivat painostettua kokouksen loppupäätelmiin suunnitelman siitä, millä aikataululla ja miten asiassa pitäisi edetä.

Italian pääministeri Enrico Letta oli tyytyväinen, että päätelmiin ujutet­tiin maininta EU-maiden keskinäisestä solidaarisuudesta ongelman rat­kaisemissa. "On tärkeää, että tämä nähdään eurooppalaisena asiana", Letta sanoi.
HS: Lähes 700 pelastui Välimerestä (http://www.hs.fi/paivanlehti/26102013/ulkomaat/Lähes+700+pelastui+Välimerestä/a1382679459020) 26.10.2013
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 26.10.2013, 22:53:59
Solidaarisuus tarkoittaa pakollista uudelleensijoittamista?

Maahanmuuttokomissaari Malmström muistuttaa taas, mistä CEAS-hankkeessa on alusta asti ollut kysymys. Turvapaikanhakijoiden uudelleensijoituksesta jäsenmaista toisiin pakollisten maakohtaisten solidaarisuuskiintiöiden perusteella.
Lainaus
Turvapaikanhakijoiden uudelleensijoitus on parhaillaan keskustelunaiheena Euroopassa ja komissaari Malmström kiteytti näkemykset: Euroopan parlamentti vaatii pakollista uudelleensijoitusta ja pakolaiskiintiöitä, joiden kautta vastuuta jaettaisiin EU:ssa tasaisemmin. (käännös)
New Europe: EU needs to reflect on relocation (http://www.neurope.eu/article/eu-needs-reflect-relocation) 25.9.2013
Lainaus
Etelä-Euroopan maat saivat painostettua kokouksen loppupäätelmiin suunnitelman siitä, millä aikataululla ja miten asiassa pitäisi edetä.

Italian pääministeri Enrico Letta oli tyytyväinen, että päätelmiin ujutet­tiin maininta EU-maiden keskinäisestä solidaarisuudesta ongelman rat­kaisemissa. "On tärkeää, että tämä nähdään eurooppalaisena asiana", Letta sanoi.
HS: Lähes 700 pelastui Välimerestä (http://www.hs.fi/paivanlehti/26102013/ulkomaat/Lähes+700+pelastui+Välimerestä/a1382679459020) 26.10.2013

Asian aikaisempi esittely suomalaisille äänestäjille ja kansanedustajille.

http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/kk_671_2012_p.shtml
Päivi Räsäsen vastaus Maria Lohelan kirjalliseen kysykseen EU:n yhteisestä turvapaikkapolitiikasta:

Lainaus
Eduskunnan työjärjestyksen 27 §:ssä mainitussa tarkoituksessa Te, Herra puhemies, olette toimittanut asianomaisen ministerin vastattavaksi kansanedustaja Maria Lohelan /ps näin kuuluvan kirjallisen kysymyksen KK 671/2012 vp:

    Kannattaako hallitus EU:n yhteistä taakanjakoa turvapaikka-asioissa,

    miten hallitus on varautunut sen tarkoittamaan turvapaikanhakijamäärien merkittävään kasvuun Suomessa ja

    onko hallitus valmis antamaan ulkopuolisen tahon määritellä sen, kuka maahan voi tulla sen sijaan, että harkinta pidetään kansallisissa käsissä?

Vastauksena kysymykseen esitän seuraavaa:

Kuten useimmat EU:n jäsenvaltiot, myös Suomi kannattaa suurta osaa komission solidaarisuutta koskevista ehdotuksista. Erityisen keskeisenä Suomi pitää lähtökohtaa, jonka mukaan perimmäinen vastuu turvapaikkajärjestelmän toimivuudesta on kullakin jäsenvaltiolla itsellään.
...
Sen sijaan Suomi ei kannata komission tiedonannossa ja myös Euroopan parlamentin päätöslauselmassa mainittua ajatusta turvapaikanhakijoiden tai kansainvälistä suojelua saavien henkilöiden siirroista EU:n sisällä. Uhkana nimittäin on, että toive siirrosta toiseen jäsenvaltioon houkuttelisi tulemaan EU:n alueelle juuri sellaisen jäsenvaltion kautta, johon maahanmuuttopainetta kohdistuu ja josta siirtoja muualle tehdään. Olisi myös varsin vaikea sopia sellaisista oikeudenmukaisista perusteista, joiden mukaan siirtyvät henkilöt ja kohdevaltiot valittaisiin.

Valtaosa jäsenvaltioista on Suomen kannalla. Kun EU:n neuvosto hyväksyi komission tiedonannon pohjalta solidaarisuutta koskevat päätelmät viime maaliskuussa, niissä korostettiin kaikkia niitä solidaarisuuden osa-alueita, joita Suomi pitää tärkeänä. Hakijoiden tai suojelua saaneiden siirtoja ei kuitenkaan haluttu edistää edes vapaaehtoisuuden pohjalta. Asiasta todettiin ainoastaan, että neuvosto tukee ajatusta tähän mennessä toteutettuja, vapaaehtoisuuteen perustuvia sisäisiä siirtoja koskevan arvioinnin tekemistä.

Komissio tai Euroopan parlamentti eivät päätä EU:n lainsäädännön sisällöstä yksin, vaan yhdessä jäsenvaltioiden kanssa. Ilman neuvoston kannatusta sääntelyä turvapaikanhakijoiden tai suojelua saaneiden siirroista jäsenvaltiosta toiseen ei EU:ssa voida tehdä. Sitä kannatusta ei ole tällä hetkellä näköpiirissä. Aktiivisella osallistumisella ja yhteistyöllä toisten jäsenvaltioiden kanssa Suomi vaikuttaa ja on jo vaikuttanut hyväksyttävien säädösten sisältöön meitä tyydyttävällä tavalla.
...
Helsingissä 4 päivänä lokakuuta 2012
Sisäasiainministeri Päivi Räsänen
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 26.10.2013, 23:34:23
Tässä vielä ne EU:n huippukokouksen päätelmät tältä osin:

Lainaus
46. Eurooppa-neuvosto ilmaisee syvän surunsa hiljattain Välimerellä tapahtuneesta satojen
ihmisten dramaattisesta menehtymisestä, joka järkytti kaikkia eurooppalaisia. Pitäen
ennaltaehkäisyä ja suojelua välttämättömyytenä ja noudattaen solidaarisuuden ja
oikeudenmukaisen vastuunjaon periaatetta
olisi toteutettava päättäväisiä toimia, jotta estetään
ihmishenkien menetykset merellä ja vältetään tällaisten inhimillisten tragedioiden
toistuminen.

47. Eurooppa-neuvosto korostaa, että on tärkeää käsitellä muuttovirtojen perussyitä tehostamalla
yhteistyötä alkuperä- ja kauttakulkumaiden kanssa, muun muassa antamalla asianmukaista
EU:n kehitystukea ja toteuttamalla tehokasta palauttamispolitiikkaa. Eurooppa-neuvosto myös
vaatii läheisempää yhteistyötä alan kansainvälisten järjestöjen, erityisesti UNHCR:n ja
Kansainvälisen siirtolaisuusjärjestön (IOM) kanssa kyseisissä kolmansissa maissa.
Ihmiskauppaa ja muuttajien salakuljetusta olisi torjuttava entistä tehokkaammin paitsi EU:n
jäsenvaltioiden alueella myös alkuperä- ja kauttakulkumaissa. Eurooppa-neuvosto kehottaa
lisäksi tehostamaan Frontexin toimia Välimerellä ja EU:n kaakkoisrajoilla. Uuden Euroopan
rajavalvontajärjestelmän (Eurosur) pikainen käyttöönotto jäsenvaltioissa on ratkaisevan
tärkeää alusten ja laittoman maahantulon havaitsemiseksi, jotta edistetään ihmishenkien
suojelemista ja pelastamista EU:n ulkorajoilla
.

48. Eurooppa-neuvosto pyytää vastaperustettua Välimeren erityistyöryhmää, jota johtaa Euroopan
komissio ja johon osallistuvat jäsenvaltiot, EU:n virastot ja EUH, määrittämään
ennaltaehkäisyn, suojelun ja solidaarisuuden periaatteiden pohjalta ensisijaiset toimet, joilla
voidaan tehostaa eurooppalaisten politiikkojen ja välineiden käyttöä. Komissio raportoi
neuvostolle tämän 5. ja 6. joulukuuta 2013 pidettävässä istunnossa
erityistyöryhmän
työskentelystä. Puheenjohtajavaltio raportoi Eurooppa-neuvostolle joulukuussa.

49. Eurooppa-neuvosto palaa muuttoliike- ja turvapaikka-asioihin laajemmasta ja pidemmän
aikavälin poliittisesta näkökulmasta kesäkuussa 2014, jolloin määritellään strategiset
suuntaviivat lainsäädännön ja operatiivisen toiminnan jatkosuunnittelulle
vapauden,
turvallisuuden ja oikeuden alueella.

http://www.consilium.europa.eu/uedocs/cms_data/docs/pressdata/fi/ec/139203.pdf

Olihan siellä jotain puhetta juurisyihin puuttumisesta, ihmiskaupan torjunnasta ja rajavalvonnasta. Ettei kuitenkin tarkoiteta vain sitä, että purtiloita seurataan tarkemmin, jotta osataan mennä hakemaan jo mereltä.

Nyt EU:ssa suunnitellaan, sopivasti itsenäisyyspäivänä väliraporttia, ja toimiin ryhdytään eurovaalien jälkeen kesäkuussa 2014.

Tämmöisiä se Jykke siellä tällä kertaa. Minkä kannan lie ottanutkaan itse kokouksessa... ja tämänköhän takia hän kävi juuri ennen kokousta Italiassa?  Saadaan Kataisen komissaarinpaikasta vielä pitkä mutta suuri lasku.

Nythän tästä pitäisi tulla eurovaaliteema jos mistä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.11.2013, 14:01:35
Lainaus
Euroopan unionin turvapaikkavirasto EASOn toiminta käynnistyi vuonna 2011. Viraston tehtävänä on edistää yhteistyötä turvapaikka-asioissa jäsenmaiden välillä ja auttaa niitä maita, joihin tulee erityisen paljon turvapaikan hakijoita. Vuonna 2012 EU-maista haki turvapaikkaa yli 330 000 ihmistä, ja tänä vuonna määrän arvioidaan kasvavan. Eniten turvapaikanhakijoita on tullut Venäjältä, Syyriasta ja Kosovosta. Turvapaikkavirasto edistää yhteisen eurooppalaisen turvapaikkajärjestelmän käyttöä. Tavoitteena on muun muassa estää turvapaikanhakijoiden siirtymisen niihin EU-maihin, jotka eivät voi taata hakijoille kohtuullisia elinolosuhteita - esimerkkinä Kreikka, jossa hakijoiden olosuhteet ovat kurjat.
Sisäministeri Räsäsen puhe EU arjessa -tapahtumassa (http://valtioneuvosto.fi/ajankohtaista/puheet/puhe/fi.jsp?oid=399946) 15.11.2013

Ministeri Räsänen varmaan tarkoittaa siirtämisen estämistä, ja sitä, että EU:n tavoitteena on estää yhä suurempi osa Dublin-palautuksista EU-maasta toiseen.

Olisikin radikaali linjaus, jos turvapaikanhakijoilta estettäisiin pääsy EU-alueelle vetoamalla siihen, että etteivät rajavaltiot "voi taata hakijoille kohtuullisia elinolosuhteita".
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 26.11.2013, 18:16:14
Lainaus
Kansainvälistä suojelua hakevan vastaanottoon liittyviä säännöksiä tarkistetaan

Sisäministeriö on asettanut hankkeen, jossa tarkistetaan kansainvälistä suojelua hakevan vastaanottoa koskevia säännöksiä. Hankkeen tavoitteena on saattaa Suomen lainsäädäntö vastaamaan EU:n muutettua vastaanottodirektiiviä, joka on osa yhteistä eurooppalaisen turvapaikkajärjestelmän säädöskokonaisuutta.

Hankkeessa valmistellaan myös valtion vastaanottokeskusten hallinnollinen yhdistäminen Maahanmuuttovirastoon. Lisäksi hankkeessa tarkistetaan ulkomaalaislakia kansainvälistä suojelua hakevalle annettavan yleisen oikeudellisen neuvonnan osalta. Hallituksen esitys on tarkoitus antaa eduskunnalle syysistuntokaudella 2014.

Tietoa hankkeesta: www.intermin.fi/fi/lainvalmistelu/muut_lainvalmisteluhankkeet/vastaanottodirektiivin_taytantoonpano (http://www.intermin.fi/fi/lainvalmistelu/muut_lainvalmisteluhankkeet/vastaanottodirektiivin_taytantoonpano)

Sisäasiainministeriö (http://www.intermin.fi/fi/ajankohtaista/uutiset/1/1/kansainvalista_suojelua_hakevan_vastaanottoon_liittyvia_saannoksia_tarkistetaan?language=fi)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: mietinen - 14.12.2013, 15:32:48
Lainaus
Yhteistä eurooppalaista turvapaikkajärjestelmää koskeva lakihanke, Sisäasiainministeriö, 2013 (http://www.intermin.fi/fi/lainvalmistelu/muut_lainvalmisteluhankkeet/yhteinen_eurooppalainen_turvapaikkajarjestelma)

 Hankkeen tavoitteena on saattaa Suomen lainsäädäntö vastaamaan eräitä yhteistä eurooppalaista turvapaikkajärjestelmää koskevia, uudelleen laadittuja EU-säädöksiä. Lainmuutosten on tarkoitus tulla voimaan viimeistään vuonna 2015.

Hankkeessa selvitetään, mitä muutostarpeita direktiivit ja asetukset aiheuttavat kansallisella tasolla. Hankkeessa valmistellaan myös tarvittavat, pääasiassa ulkomaalaislakia koskevat muutosehdotukset.

Hankkeen aluksi keväällä 2013 tehdään määritelmädirektiiviä koskeva selvitys. Määritelmädirektiivin lisäksi hankkeessa käsitellään turvapaikkamenettelydirektiiviä sekä vastuunmäärittämis- ja Eurodac-asetuksia. Yhteisen eurooppalaisen turvapaikkajärjestelmän säädöskokonaisuuteen kuuluu myös uudelleen laadittu vastaanottodirektiivi, mutta sen täytäntöönpano toteutetaan eri hankkeessa, koska sen vaikutukset kohdistuvat pääasiassa vastaanottolakiin.
Taustaa lyhyesti

Määritelmädirektiivissä määritellään, ketkä voivat saada kansainvälistä suojelua EU-maissa. Siinä säädetään myös kansainvälistä suojelua saaville annettavista oikeuksista ja etuuksista. Direktiivi on annettu 13.12.2011 ja se on saatettava kansallisesti voimaan joulukuuhun 2013 mennessä.

Turvapaikkamenettelydirektiivissä säädetään kansainvälisen suojelun myöntämistä koskevista menettelyistä EU-maissa. Direktiivin sisällöstä ollaan pääsemässä EU-tasolla yhteisymmärrykseen. Direktiivin odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana, jolloin se olisi saatettava kansallisesti voimaan kevään 2015 aikana.

Vastuunmäärittämisasetus (Dublin II) määrittää sen, minkä maan vastuulla on käsitellä jäsenvaltioiden alueella jätetty kansainvälistä suojelua koskeva hakemus. Asetuksen sisällöstä on päästy poliittiseen yhteisymmärrykseen EU-tasolla ja sen odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana.

Eurodac-asetuksella on perustettu Eurodac-sormenjälkijärjestelmä, jonka päätarkoituksena on tehostaa vastuunmäärittämisasetuksen soveltamista. Asetuksen sisällöstä ollaan pääsemässä yhteisymmärrykseen ja sen odotetaan tulevan virallisesti hyväksytyksi kevään 2013 aikana.
Valmisteluvaihe

Hankkeen toimikausi on 15.1.2013 - 31.5.2015.

Lausunnolle lähtenyt esitys 20.11.2013 (http://www.intermin.fi/download/48668_maaritelmadirektiivi_lausunnolle_luonnos_20112013.pdf)
Lausuntopyynto 20.11.2013 (http://www.intermin.fi/download/48669_maaritelmadirektiivi_lausuntopyynto_20112013.pdf)



myös
1. Lakiehdotus turvapaikanhakijoille myönnettävää suojelua koskevasta direktiivistä lausunnolle | 20.11.2013 (http://www.intermin.fi/fi/ajankohtaista/uutiset/1/1/lakiehdotus_turvapaikanhakijoille_myonnettavaa_suojelua_koskevasta_direktiivista_lausunnolle)
2.
Lainaus
http://www.intermin.fi/fi/lainvalmistelu/muut_lainvalmisteluhankkeet
Maahanmuuttoon liittyvät hankkeet

Ulkomaalaislain tarkistaminen suhteessa Schengenin rajasäännöstöön
Yhdistelmälupadirektiivin täytäntöönpano
Pitkään oleskelleiden kolmansien maiden kansalaisten asemaa koskevan direktiivin täytäntöönpano
Vapaaehtoisen paluun järjestelmän vakiinnuttaminen
Yhteinen eurooppalainen turvapaikkajärjestelmä
Ulkomaalaisvalvonnan kehittäminen
Vastaanottodirektiivin täytäntöönpano

Asetusten valmistelu
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 10.01.2014, 22:57:00
Lehtitietojen mukaan Kreikka näyttäisi olevan pyrkimässä jättämään jälkeään näihin asioihin juuri alkaneella puheenjohtajakaudellaan. Puhuu kyllä rajavalvonnan tehostamisesta, mutta myös taakanjaosta.

Ainakin minä toivon PS:ltä näiden pyrkimysten aktiivista esilläpitämistä eurovaalikampanjassa - Australian käytännöillä ryyditettynä, mikäli sudenkuoppia ei havaita.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.01.2014, 23:11:38
Lainaus
The minister said in a press conference that an agreement had to be achieved on the measures to share the burden of undocumented migrants unable to return to their home countries among EU nations. The clause could operate on the basis of the application of parameters such as GDP, population, etc. ”The important thing is to keep the debate open,” he added. ‘

‘We can’t be overly optimistic, given that many countries are very much against the idea.” Interior Minister Yiannis Michelakis said that ”solidarity should translate into stable, permanent mechanisms” for more equitable burden sharing between the countries hit the hardest and their EU partners.
ANSAmed: EU presidency aims for immigration burden sharing (http://www.ansamed.info/ansamed/en/news/nations/europe/2014/01/09/Immigration-EU-presidency-aims-burden-sharing_9873499.html) 9.1.2014

EU-puheenjohtajamaa Kreikan mukaan EU:n on luotava laittomien siirtolaisten jakamiseen pysyvä solidaarisuusmekanismi, joka perustuisi esimerkiksi sellaisiin parametreihin kuin jäsenvaltioiden bruttokansantuote, väkiluku jne.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Emo - 10.01.2014, 23:24:02
^ Ai? Laittomat siirtolaiset on siis jaettava jäsenmaiden kesken, ei poistettava EU:n alueelta?
Tulkoon sota Eurooppaan ja tulkoon se PIAN, jotta siitä olisi hyötyä!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 11.01.2014, 10:45:56
Taas toistan itseäni...

Kreikkalaisillehan pitäisi sanoa, että päin vastoin. Kreikan pitäisi ottaa hoitaakseen myös muihin EU-maihin laittomasti tulleet maahantunkeutujat. Edes jotain vastinetta niistä sadoista miljardeista euroista, joilla muut EU-maat ovat tukeneet Kreikkaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 17.02.2014, 15:01:33
Lainaus
Euroopan komissio on työskennellyt vuosia työstämässä luonnosesitystä, jolla turvapaikanhakijat ja pakolaiset jaettaisiin Euroopassa. Ehdotetun lainsäädännön mukaan koulutetut työläiset jaettaisiin jäsenmaihin paikallisten tarpeiden ja ammattipätevyyden mukaan. Jakoprosessia tulee koordinoimaan keskitetty eurooppalainen yhteyspiste.  (käännös)
Deutsche Welle: The road to EU asylum remains bumpy (http://www.dw.de/the-road-to-eu-asylum-remains-bumpy/a-17429648) 13.2.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 25.02.2014, 20:08:16
Euroopan komissio: Rohkeampi ote EU maahanmuuttopolitiikkaan (http://www.asianajajaliitto.fi/viestinta/oikeudellisia_uutisia/euroopan_unioni/euroopan_komissio_rohkeampi_ote_eu_maahanmuuttopolitiikkaan.7632.news)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tosiasiallinen Nuiva - 25.02.2014, 20:15:53
Euroopan komissio: Rohkeampi ote EU maahanmuuttopolitiikkaan (http://www.asianajajaliitto.fi/viestinta/oikeudellisia_uutisia/euroopan_unioni/euroopan_komissio_rohkeampi_ote_eu_maahanmuuttopolitiikkaan.7632.news)

Luin juttua tähän asti:
Lainaus
Sisäasioista vastaavan komissaari Cecilia Malmströmin mukaan hyvin hallittu maahanmuutto voi aidosti hyödyttää sekä tulijoita että lähtö- ja kohdemaita.

Sitten lopetin, koska loput on helppo arvata kun sanojana on Cecilia Julma.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 09.03.2014, 18:02:45
Lainaus
Ruotsi haluaa muun EU:n jakavan pakolaistaakkaa

Pyytää Euroopan komissiota rankaisemaan maita, jotka eivät tee osuuttaan

Viime syyskuussa Ruotsista tuli ainoa EU-maa, joka tarjoaa pysyvän oleskeluluvan syyrialaisille, jotka pakenevat kotimaansa hävitystä. Nyt oman anteliaisuutensa näännyttämänä se on menettämässä kärsivällisyytensä siihen, mitä se kutsuu muiden Euroopan maiden solidaarisuuden puutteeksi.

"Yhdeksän EU-jäsenmaata ottaa nykyään vastaan 90 prosenttia turvapaikkahakemuksista, mutta nämä yhdeksän maata alkavat olla melkoisen tympääntyneitä", Ruotsin maahanmuuttoministeri Tobias Billström sanoi haastattelussa. Hän vaatii Euroopan komissiota rankaisemaan niitä maita, jotka eivät täytä osuuttaan turvapaikanhakijoiden vastaanotossa EU-sääntöjen mukaisesti.

[...]

Turvapaikanhakijoiden määrän kasvaminen on rasittanut viranomaisia, joiden on määrä huolehtia koulutuksesta, lastenhoidosta ja muusta tuesta. Yksi suuri haaste on turvapaikanhakijoiden turvallinen majoitus, kun Ruotsissa on asuntopula.

Kasvanut kysyntä on nostanut hintoja, ja Ruotsin maahanmuuttovirasto arvioi maksavansa tänä vuonna 1,9 miljardia kruunua maahanmuuttajien asuttamisesta, mikä on 250 prosenttia enemmän kuin vuonna 2012. Osa kasvusta johtuu siitä, että viranomaisten ovat etsineet kalliimpaa majoitusta kuten hotelleja ja konferenssikeskuksia, kun normaalit majoituspaikat ovat täyttyneet.

[...]

Brysselin ministerikokouksessa pohjoisen ja etelän välisen kiistan odotetaan olevan kiihkeä. Välimeren maat väittävät, että ne on jätetty selviytymään maahanmuuttovirroista yksinään. Pohjoiset valtiot taas syyttävät etelän tarkoituksella sallivan pakolaisten matkustaa rikkaampiin maihin hakemaan turvapaikkaa, kun ne eivät käsittele hakemuksia.

EU-lain mukaan pakolaisten on rekisteröidyttävä ja haettava turvapaikkaa siitä maasta, jonka kautta he saapuvat.

[...]

Yksi pakolaisista on 28-vuotias Khassa Rachit, joka asuu pienessä mökissä Bergbyn Gårdissa odottaen oleskelulupaa, joka mahdollistaa hänen vaimonsa ja kahden lapsensa saapumisen laillisesti Syyriasta. (..) Pitkän suunnittelun jälkeen hän maksoi salakuljettajille 16 000 euroa päästäkseen Ruotsiin.  (käännös)
The Wall Street Journal: Sweden Wants Rest of EU to Share Refugee Burden (http://online.wsj.com/news/articles/SB10001424052702304815004579417171281318050) 3.3.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: veikko1980 - 11.03.2014, 20:14:59
Cecilia Malmström

EU Commissioner for Home Affairs

The Future of Home Affairs: an Open and Secure Europe

Press Conference, European Parliament

Strasbourg, 11 March 2014

When I took office as EU Commissioner for Home Affairs in 2009, an ambitious agenda was set out by the Stockholm program.

Now, almost five years later, we can be proud of what has been achieved to make Europe more open, more protective and more secure.

A Common European Asylum System is now in place and we have improved standards for those coming to Europe to seek protection from persecution and violence.

We have reinforced the governance of the Schengen zone and guaranteed free movement within this area without controls at internal borders. Schengen is one of the most tangible achievements of the European Union and one of those most cherished by European citizens.

We have abolished visa requirements for a number of countries, such as the countries of the Western Balkans, Brazil, Taiwan and have strengthened our ties with countries in our direct neighborhood.

We have launched a visa dialogue and signed a readmission agreement with Turkey and Mobility Partnerships have been agreed with Tunisia, Morocco, Moldova, Armenia, and Georgia.

We have developed common tools to improve the protection of European societies and economies from serious and organized crime.

We have put in place effective policies and legislation in the fight against trafficking in human beings to better protect victims and making it easier to prosecute criminals.

New European rules and sanctions are in place to prevent and fight child sexual abuse. We have managed to set up a Global Alliance against pedopornography, currently consisting of 52 states worldwide.

We have introduced tough new measures to combat the growing threat of cybercrime. We set up the European Cybercrime Centre (EC3) and brought in EU legislation to deal more efficiently with the growing number of cyber-attacks, including by outlawing the use, sale and production of botnets.

We have produced the first ever EU anti-corruption report to support efforts to fight corruption in Member States, and we have taken important steps to improve the EU rules on the confiscation of mafias assets.

To combat growing extremism in Europe, the Radicalisation Awareness Network (RAN), consisting of around 700 European practitioners was set up.

So, important steps have been taken in areas that are close to all European citizens.  But the work is not over.

While there is a need to implement the agreed legislation and consolidate the existing framework, the European Union and its Member States will be confronted with new challenges.

For example, more people will want to come to Europe to work, as tourists, to study or to seek protection.

At the same time Europe will go through a phase of demographic change and serious shortages in its labor market, at a moment when competition for global talent is heating up.

If we want to attract talented individuals, we need to implement more flexible admission and visa policies for economic migrants.

We will be confronted with further instability in our neighborhood, such as the consequences of the Syrian conflict. Giving new impetus to resettlement and creating channels to grant protection outside of the EU territory are the way forward.

We must step up our efforts in order to avoid last year's tragic incident in Lampedusa from reoccurring. To this extent we have to better cooperate with countries of origin and transit of the migrants fostering e parallel approach to open new ways for legal migration while at the same time fighting together the criminal networks that are behind these deadly journeys.

Technology is moving fast, providing new opportunities for economic growth and changing the way we connect with each other. But these changes bring about new security challenges.

Globalization and the expansion of international trade allow organized crime to expand its activities. This is why we need to adapt to this growing challenge and find new ways to prevent organized crime from penetrating the legal market.

The answers we will give to the many challenges ahead of us will indicate the way forward for the area of Freedom, Security and Justice and will shape the Europe of tomorrow.

The Europe I would want is a Europe open to the world, welcoming students, researchers and others that bring the skills and talents we need to ensure our levels of prosperity. It is a Europe built on respect of fundamental rights that provides protection to those in need. It is a Europe that provides security to its citizens.

The Europe I would want is upholding its core values and is based on cooperation and effective solidarity. It is a Europe able to translate the concepts of solidarity and sharing of responsibility anchored in the Treaties, into concrete measures and activities. This requires Member States and European institutions to join forces and share their resources.

The European Council's guidelines on the future of the Freedom Security and Justice area will be decided in June at a time where euro-skeptics make their voices heard loudly and where nationalism and xenophobia are on the rise.

Let us hope that the Heads of States and Government will demonstrate political courage and give a clear signal that Europe will not compromise on its core values.

The European Union is an area of freedom, security and justice where democracy, the rule of law and respect for human rights are upheld. We should look to safeguard these principles as we develop our policies for the coming years.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.03.2014, 22:33:52
Cecilia Malmström
...
Giving new impetus to resettlement and creating channels to grant protection outside of the EU territory are the way forward.

Siinäpä haaveilee. Malmström on äyskinyt ympäriinsä, kun hänen (ja silloisen maahanmuuttoministeri Astrid Thorsin) arabikevään aikana ajamansa väliaikaisen suojelun direktiivin aktivoiminen ei mennyt läpi. Se olisi tarkoittanut kaikkien arabikevätmaissa asuvien vapaata pääsyä Eurooppaan, oleskelulupia, sosiaaliturvaa ja majoitusta muutamaksi vuodeksi ilman turvapaikkatutkintaa. Se olisikin ollut toteutuessaan järkyttävä virheliike, joka olisi rampauttanut koko Euroopan kymmeniksi vuosiksi. Myöskään turvapaikanhakijoiden vastaanottopisteiden perustaminen Pohjois-Afrikkaan ei onnistunut, eikä kiintiöpakolaisten vastaanottoon (alle 10 000) ja turvapaikanhakijoiden siirtämiseen jäsenmaista toiseen (alle 1 000) ole ollut läheskään sellaista kiinnostusta kuin Malmström toivoi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: veikko1980 - 11.03.2014, 23:45:56
Cecilia Malmström
...
Giving new impetus to resettlement and creating channels to grant protection outside of the EU territory are the way forward.

Siinäpä haaveilee. Malmström on äyskinyt ympäriinsä, kun hänen (ja silloisen maahanmuuttoministeri Astrid Thorsin) arabikevään aikana ajamansa väliaikaisen suojelun direktiivin aktivoiminen ei mennyt läpi. Se olisi tarkoittanut kaikkien arabikevätmaissa asuvien vapaata pääsyä Eurooppaan, oleskelulupia, sosiaaliturvaa ja majoitusta muutamaksi vuodeksi ilman turvapaikkatutkintaa. Se olisikin ollut toteutuessaan järkyttävä virheliike, joka olisi rampauttanut koko Euroopan kymmeniksi vuosiksi. Myöskään turvapaikanhakijoiden vastaanottopisteiden perustaminen Pohjois-Afrikkaan ei onnistunut, eikä kiintiöpakolaisten vastaanottoon (alle 10 000) ja turvapaikanhakijoiden siirtämiseen jäsenmaista toiseen (alle 1 000) ole ollut läheskään sellaista kiinnostusta kuin Malmström toivoi.
työttmyys eu ja euroalueella 11 ja 12 %. Ja lisää työttömiä tulee kun luodaan ''kanavia'' jotta hanke pystytään toteuttamaan
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.04.2014, 19:04:14
Malmström on äyskinyt ympäriinsä, kun hänen (ja silloisen maahanmuuttoministeri Astrid Thorsin) arabikevään aikana ajamansa väliaikaisen suojelun direktiivin aktivoiminen ei mennyt läpi. Se olisi tarkoittanut kaikkien arabikevätmaissa asuvien vapaata pääsyä Eurooppaan, oleskelulupia, sosiaaliturvaa ja majoitusta muutamaksi vuodeksi ilman turvapaikkatutkintaa. Se olisikin ollut toteutuessaan järkyttävä virheliike, joka olisi rampauttanut koko Euroopan kymmeniksi vuosiksi. Myöskään turvapaikanhakijoiden vastaanottopisteiden perustaminen Pohjois-Afrikkaan ei onnistunut, eikä kiintiöpakolaisten vastaanottoon (alle 10 000) ja turvapaikanhakijoiden siirtämiseen jäsenmaista toiseen (alle 1 000) ole ollut läheskään sellaista kiinnostusta kuin Malmström toivoi.

Lainaus
Toimittaja
Millaiselta eurooppalaisen turvapaikkapolitiikan pitäisi näyttää?

Europarlamentaarikko Cecilia Wikström
Haluan, että ihmiset voivat hakea turvapaikkaa kaikista EU:n suurlähetystöistä ja että me perustamme väliaikaisia turvapaikanhakutoimistoja sinne, missä on pakolaisia. Ensinnäkin haluan muut puolueet tämän taakse, sitten haluan lakiehdotuksen komissiolta. Ja sitten haluan EU-raportoijaksi [asiasta vastaavaksi EU-parlamentaarikoksi] asiassa. Ja sitten haluan kangeta hankkeen loppuun saakka.

Toimittaja
Eikä se tarkoita, että koko Syyrian väestö voisi hakea ja saada turvapaikan EU:sta?

Europarlamentaarikko Cecilia Wikström
Kyllä, mutta jos heidät hajautettaisiin ympäri EU:ta, se on mahdollista. Nykyään vain 10 maata ottaa vastaan 90 prosenttia kaikista turvapaikanhakijoista. 18 maata ei tee mitään.  (käännös)
Europortalen: Cecilia Wikström: Jag törs säga F-ordet (http://www.europaportalen.se/2014/04/cecilia-wikstrom-jag-tors-saga-f-ordet)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tosiasiallinen Nuiva - 16.04.2014, 19:09:14
Malmström on äyskinyt ympäriinsä, kun hänen (ja silloisen maahanmuuttoministeri Astrid Thorsin) arabikevään aikana ajamansa väliaikaisen suojelun direktiivin aktivoiminen ei mennyt läpi. Se olisi tarkoittanut kaikkien arabikevätmaissa asuvien vapaata pääsyä Eurooppaan, oleskelulupia, sosiaaliturvaa ja majoitusta muutamaksi vuodeksi ilman turvapaikkatutkintaa. Se olisikin ollut toteutuessaan järkyttävä virheliike, joka olisi rampauttanut koko Euroopan kymmeniksi vuosiksi. Myöskään turvapaikanhakijoiden vastaanottopisteiden perustaminen Pohjois-Afrikkaan ei onnistunut, eikä kiintiöpakolaisten vastaanottoon (alle 10 000) ja turvapaikanhakijoiden siirtämiseen jäsenmaista toiseen (alle 1 000) ole ollut läheskään sellaista kiinnostusta kuin Malmström toivoi.

Lainaus
Toimittaja
Millaiselta eurooppalaisen turvapaikkapolitiikan pitäisi näyttää?

Europarlamentaarikko Cecilia Wikström
Haluan, että ihmiset voivat hakea turvapaikkaa kaikista EU:n suurlähetystöistä ja että me perustamme väliaikaisia turvapaikanhakutoimistoja sinne, missä on pakolaisia. Ensinnäkin haluan muut puolueet tämän taakse, sitten haluan lakiehdotuksen komissiolta. Ja sitten haluan EU-raportoijaksi [asiasta vastaavaksi EU-parlamentaarikoksi] asiassa. Ja sitten haluan kangeta hankkeen loppuun saakka.

Toimittaja
Eikä se tarkoita, että koko Syyrian väestö voisi hakea ja saada turvapaikan EU:sta?

Europarlamentaarikko Cecilia Wikström
Kyllä, mutta jos heidät hajautettaisiin ympäri EU:ta, se on mahdollista. Nykyään vain 10 maata ottaa vastaan 90 prosenttia kaikista turvapaikanhakijoista. 18 maata ei tee mitään.  (käännös)
Europortalen: Cecilia Wikström: Jag törs säga F-ordet (http://www.europaportalen.se/2014/04/cecilia-wikstrom-jag-tors-saga-f-ordet)

Muistelen että joskus koko väestön siirtäminen muualle oli rikos ihmisyyttä vastaan.

Nyt se on valtavirtaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Sitruunamelissa - 16.04.2014, 19:39:15
Euroopan komissio: Rohkeampi ote EU maahanmuuttopolitiikkaan (http://www.asianajajaliitto.fi/viestinta/oikeudellisia_uutisia/euroopan_unioni/euroopan_komissio_rohkeampi_ote_eu_maahanmuuttopolitiikkaan.7632.news)

Tämähän oli mielenkiintoinen. Nostaisin tällaisen kohdan esille (boldaukset omia):
Lainaus
Liikkuvuuskumppanuudet ovat osoittautuneet tehokkaiksi välineiksi käsitellä maahanmuutto- ja turvapaikka-asioita molempia osapuolia hyödyttävällä tavalla. Kumppanuuden puitteissa sovitaan poliittisista tavoitteista, ja ne toimivat keskustelu- ja yhteistyökehyksenä. Toistaiseksi liikkuvuuskumppanuus on solmittu kuuden maan kanssa: Moldova (2008), Kap Verde (2008), Georgia (2009), Armenia (2011), Marokko (2013) ja Azerbaidžan (2013). Keskustelut Tunisian kanssa saatiin päätökseen marraskuussa 2013, ja kumppanuus on määrä allekirjoittaa pian. Vastaavat keskustelut Jordanian kanssa aloitettiin joulukuussa 2013.

Komissio tuki vuosina 2012 ja 2013 yli 90:tä muuttoliikehanketta yli 200 miljoonalla eurolla kaikilla kolmannen maailman alueilla. Lisäksi EU:n jäsenvaltiot ovat lisänneet kokonaisvaltaisen lähestymistavan täytäntöönpanoon myöntämäänsä rahoitusta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: foobar - 16.04.2014, 19:46:10
Tämähän oli mielenkiintoinen. Nostaisin tällaisen kohdan esille (boldaukset omia):
Lainaus
Lisäksi EU:n jäsenvaltiot ovat lisänneet kokonaisvaltaisen lähestymistavan täytäntöönpanoon myöntämäänsä rahoitusta.[/b]

Saksassa ja Neuvostoliitossa harrastettiin aikanaan myös tuota kokonaisvaltaisen lähestymistavan täytäntöönpanoa. Tavoitteena vaikutti toistuvasti olevan jonkin kansanryhmän elämän paskaksi muuttaminen. Harvemmin kuitenkaan oman. Oli tosin silloinkin niitä, jotka kärkkyivät lakeijapaikkoja vaatimalla vaatien kanssakansalaistensa uhraamista aatteen alttarille.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Reinhardt42 - 16.04.2014, 19:57:19
Mikään sanallinen tai kirjallinen ei riitä likimainkaan ilmaisemaan halveksuntaani komissaari Malmströmiä kohtaan.
Ihmettelin joskus suuresti miten on mahdollista että maahanmuuttoasioista vastaavana EU:n korkeimpana virkamiehenä toimii tämä ruotsalainen fanaatikko.
Kunnes tajusin että kyseessähän onkin nimenomaan EU ja Cecilia on todellakin Ruotsista.
Joskus vastaus on lähempänä kuin uskoisikaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tykkimies Pönni - 16.04.2014, 20:24:25
Euroopan komissio: Rohkeampi ote EU maahanmuuttopolitiikkaan (http://www.asianajajaliitto.fi/viestinta/oikeudellisia_uutisia/euroopan_unioni/euroopan_komissio_rohkeampi_ote_eu_maahanmuuttopolitiikkaan.7632.news)

Tämähän oli mielenkiintoinen. Nostaisin tällaisen kohdan esille (boldaukset omia):
Lainaus
Liikkuvuuskumppanuudet ovat osoittautuneet tehokkaiksi välineiksi käsitellä maahanmuutto- ja turvapaikka-asioita molempia osapuolia hyödyttävällä tavalla. Kumppanuuden puitteissa sovitaan poliittisista tavoitteista, ja ne toimivat keskustelu- ja yhteistyökehyksenä. Toistaiseksi liikkuvuuskumppanuus on solmittu kuuden maan kanssa: Moldova (2008), Kap Verde (2008), Georgia (2009), Armenia (2011), Marokko (2013) ja Azerbaidžan (2013). Keskustelut Tunisian kanssa saatiin päätökseen marraskuussa 2013, ja kumppanuus on määrä allekirjoittaa pian. Vastaavat keskustelut Jordanian kanssa aloitettiin joulukuussa 2013.

Komissio tuki vuosina 2012 ja 2013 yli 90:tä muuttoliikehanketta yli 200 miljoonalla eurolla kaikilla kolmannen maailman alueilla. Lisäksi EU:n jäsenvaltiot ovat lisänneet kokonaisvaltaisen lähestymistavan täytäntöönpanoon myöntämäänsä rahoitusta.


Väittääkö joku vielä ettei mamutus ole keskusjohdettua toimintaa? Väittääkö joku ettei ne tiedä mamutuksen massiivisia negatiivisia seurauksia?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 17.04.2014, 20:28:01
Mikään sanallinen tai kirjallinen ei riitä likimainkaan ilmaisemaan halveksuntaani komissaari Malmströmiä kohtaan. Ihmettelin joskus suuresti miten on mahdollista että maahanmuuttoasioista vastaavana EU:n korkeimpana virkamiehenä toimii tämä ruotsalainen fanaatikko. Kunnes tajusin että kyseessähän onkin nimenomaan EU ja Cecilia on todellakin Ruotsista. Joskus vastaus on lähempänä kuin uskoisikaan.

Luulin ensin, että Roopen viestissä (https://hommaforum.org/index.php/topic,58569.msg1606261.html#msg1606261) mainittu Cecilia olisi ollut Ruotsin oma EU-komissaari Cecilia Malmström, mutta näköjään kyseessä onkin toinen Cecilia, joka on sukunimeltään Wikström ja titteliltään europarlamentaarikko. Molempien Cecilioiden turvapaikkalinjaukset ovat yhtä päättömiä. Siksi ruotsalaisesta turvapaikka- ja pakolaispolitiikasta voisi ruveta käyttämään termiä cecilialismi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 17.04.2014, 23:16:36
Mikään sanallinen tai kirjallinen ei riitä likimainkaan ilmaisemaan halveksuntaani komissaari Malmströmiä kohtaan.
Ihmettelin joskus suuresti miten on mahdollista että maahanmuuttoasioista vastaavana EU:n korkeimpana virkamiehenä toimii tämä ruotsalainen fanaatikko.
Kunnes tajusin että kyseessähän onkin nimenomaan EU ja Cecilia on todellakin Ruotsista.
Joskus vastaus on lähempänä kuin uskoisikaan.

Jussin ja kumppaneiden e n s i m m ä i n e n  tehtävä on estää maahanmuutosta vastaavan komissaarin valitseminen cecilianismia edustavien tai edes sietävien  "ajatus"suuntausten riveistä. Etten sanoisi, että Terho oikeus- ja sisäasiainkomissaariksi!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 19.04.2014, 16:19:32
Maahantunkijoiden käännyttäminen ei kohta onnistu edes rajalla...

2014-04-18 Irish Times: New EU rules to protect migrants outlaw ‘pushback’ operations (http://www.irishtimes.com/news/world/europe/new-eu-rules-to-protect-migrants-outlaw-pushback-operations-1.1765530)

New rules on the treatment of migrants who enter the European Union will come into effect this summer as the European Parliament passed a new law governing the operation of Frontex, the EU’s border control agency.

In the last plenary session of the parliament before next month’s European elections, MEPs voted overwhelmingly for new rules that will ensure migrants who are in need of international protection will be given appropriate help when they cross the EU’s external borders, whether by land, sea or air. They also outlaw so-called “pushback” operations in which border guards turn back boats carrying immigrants.


EU Puheenvuorot - Ulkoisten merirajojen vartiointi (keskustelu) (http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-//EP//TEXT+CRE+20140415+ITEM-020+DOC+XML+V0//FI)(ei käännetty vielä)
Tiistai 15. huhtikuuta 2014 - Strasbourg

Cecilia Malmström näyttää tykkäävän, joten tämä on askel huonompaan suuntaan :(
edit: Ei jumalauta, joku kehtaa verrata Lampedusaa Ellis Islandiin :facepalm:  :facepalm:  :facepalm:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Reinhardt42 - 19.04.2014, 16:38:25
Mikään sanallinen tai kirjallinen ei riitä likimainkaan ilmaisemaan halveksuntaani komissaari Malmströmiä kohtaan. Ihmettelin joskus suuresti miten on mahdollista että maahanmuuttoasioista vastaavana EU:n korkeimpana virkamiehenä toimii tämä ruotsalainen fanaatikko. Kunnes tajusin että kyseessähän onkin nimenomaan EU ja Cecilia on todellakin Ruotsista. Joskus vastaus on lähempänä kuin uskoisikaan.

Luulin ensin, että Roopen viestissä (https://hommaforum.org/index.php/topic,58569.msg1606261.html#msg1606261) mainittu Cecilia olisi ollut Ruotsin oma EU-komissaari Cecilia Malmström, mutta näköjään kyseessä onkin toinen Cecilia, joka on sukunimeltään Wikström ja titteliltään europarlamentaarikko. Molempien Cecilioiden turvapaikkalinjaukset ovat yhtä päättömiä. Siksi ruotsalaisesta turvapaikka- ja pakolaispolitiikasta voisi ruveta käyttämään termiä cecilialismi.

Kappas. Sotkin itsekin Ceciliat keskenään. Hulluja kaimoja näköjään komissaarilla Svedustaniassa piisaa. Cecilianismihan sopii oikein hyvin termiksi kuvaamaan ruotsalaisten intoa väestönvaihtoon ja mokueugeniikkaan.
Osoituksena toimii että vaikka Ceciliat menivätkin sekaisin, ei lausumani viestin sisältö silti kärsinyt lainkaan, ruotsalaiset poliitikkoceciliat mokuttavat olan takaa MOT  ;D.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jari Leino - 27.04.2014, 22:23:55
Keskustelua eduskunnassa määritelmädirektiivistä.

Erittäin hyviä puheenvuoroja useilta perussuomalaisilta.


KESKIVIIKKONA 23. HUHTIKUUTA 2014 kello 14.08
6)  Hallituksen esitys eduskunnalle laiksi ulkomaalaislain muuttamisesta

http://www.eduskunta.fi/faktatmp/utatmp/akxtmp/ptk_42_2014_ke_p_2.shtml
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.04.2014, 16:23:21
Lainaus
Euroopan poliittiset johtajat jatkavat tiukkaa linjaa EU:n turvapaikkapolitiikassa. Maahanmuuttoasiantuntija Jochen Oltmerin mukaan EU:n täytyy määritellä uudelleen, miten se käsittelee pakolaisia.

[...]

Jochen Oltmer: Tällaiset näyttävät ja liikuttavat kuvat Lampedusalta ja muualtakin antavat vaikutelman siitä, että EU:hun on tulossa paljon pakolaisia. Poliitikot haluavat käyttää näitä näyttäviä tapahtumia puolustellakseen omaa ekskluusiopolitiikkaansa. Mutta globaali siirtolaisuus tapahtuu etupäässä kehittyneiden valtioiden välillä. Saksan maahanmuuttokeskuksen lukujen mukaan 80 prosenttia Saksana maahanmuuttajista tulee toisista EU-maista. (..) Mutta kehittymättömien ja kehittyneiden maiden välillä ei tapahdu juuri mitään. Invaasio on myytti, johon on rohkaistu vuosikymmeniä, mutta sillä ei ole mitään tekemistä todellisten globaalien lukujen kanssa.

Toimittaja: Miksi EU sitten vaikuttaa olevan niin suljettu siirtolaisilta?

Jochen Oltmer: Siirtolaisuutta pidetään jonakin kielteisenä. Taakkana työmarkkinoille, maahanmuuttoon liittyvinä turvallisuusriskeinä, taakkana sosiaaliturvajärjestelmälle - nämä kolme asiaa tuodaan esiin välittömästi, kun keskustellaan siirtolaisuudesta. Ja voimme nähdä viime viikkojen poliittisesta keskustelusta, millä voimalla tämä puolustusmekanismi otetaan käyttöön, vaikka puhumme tosi pienistä luvuista.

Toimittaja: Kuinka siirtolaisten hyväksymistä voidaan lisätä?

Jochen Oltmer: Ei todellakaan ole tarpeeksi järjestelyjä, joilla pakolaiset otettaisiin vastaan nopeasti ja ilman konflikteja. Ei myöskään ole tarpeeksi tietoisuutta faktasta, että pakolaisten vastaanottaminen on välttämätöntä. Aina kun pakolaismäärät kasvavat jossain, EU:lla on vaikeuksia vastaanoton, sijoittamisen, rahoituksen ja paljon muun kanssa. Yksi idea olisi EU:n laajuinen uudelleensijoittaminen, jossa olisi selkeät kriteerit, mahdollisesti perustuen väkilukuun ja verotuloihin. Tällä tavalla ei olisi aina kateutta ja pahaa mieltä, eikä pakolaisia käytettäisi politiikan välineenä.  (käännös)
Deutsche Welle: EU needs to rethink its refugee policy' (http://www.dw.de/eu-needs-to-rethink-its-refugee-policy/a-17188912) 28.4.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 28.04.2014, 17:21:15
Yksi idea olisi EU:n laajuinen uudelleensijoittaminen, jossa olisi selkeät kriteerit, mahdollisesti perustuen väkilukuun ja verotuloihin. Tällä tavalla ei olisi aina kateutta ja pahaa mieltä, eikä pakolaisia käytettäisi politiikan välineenä.[/b]  (käännös)
Deutsche Welle: EU needs to rethink its refugee policy' (http://www.dw.de/eu-needs-to-rethink-its-refugee-policy/a-17188912) 28.4.2014
[/quote]

Toivottavasti edes se pinta-alaan perustuva sijoittaminen on poistunut vaihtoehdoista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.04.2014, 11:29:44
Lainaus
Tulisiko EU:ssa olla enemmän yhteisvastuuta ja missä kysymyksissä?

Tarja Cronberg:

"Kyllä. Jäsenmaat ovat hyvin riippuvaisia toisistaan jo nyt, jo pelkästään taloudellisesti.  Yhteistä politiikkaa tarvitaan muun muassa maahanmuutto- ja turvapaikkakysymyksissä. Euroopan lähialueiden kriisit ovat ajaneet maahanmuuttajia etenkin Italiaan, Espanjaan ja Kreikkaan. Nämä maat eivät voi yksin ottaa kaikkia tulijoita vastaan. Tarvitaan myös laillisia keinoja tulla EU-alueelle, ja vastuunjakoa EU-maiden kesken."
FIPSU: MEP-ehdokkaiden haastattelu: Tarja Cronberg ja Anneli Jäätteenmäki (http://www.fipsu.com/?x118165=218244) 28.4.2014

Vastuunjaon ja laillisten keinojen lisäämisen puolesta puhuvat poliitikot kertovat harvoin tai paremminkin ei koskaan, mitä heidän vaatimuksensa käytännössä tarkoittavat. Cronbergkin puhuu oikeasti vastaanotettavien pakolaisten (sekä laittomien siirtolaisten) määrän moninkertaistamisesta ja käsittämättömän suurista kustannuksista.

Mitä helpommaksi ulkorajamaista pohjoisen sosiaaliturvavaltioihin pyrkiminen tehdään, sitä houkuttelevammaksi koko Eurooppa muuttuu, ja sitä enemmän paineita kohdistuu myös ulkorajamaihin. Tätä noidankehää ei voi purkaa maahanmuuttoa helpottamalla tai resursseja loputtomiin lisäämällä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Golimar - 29.04.2014, 11:53:24
Lainaus
Tulisiko EU:ssa olla enemmän yhteisvastuuta ja missä kysymyksissä?

Tarja Cronberg:

"Kyllä. Jäsenmaat ovat hyvin riippuvaisia toisistaan jo nyt, jo pelkästään taloudellisesti.  Yhteistä politiikkaa tarvitaan muun muassa maahanmuutto- ja turvapaikkakysymyksissä. Euroopan lähialueiden kriisit ovat ajaneet maahanmuuttajia etenkin Italiaan, Espanjaan ja Kreikkaan. Nämä maat eivät voi yksin ottaa kaikkia tulijoita vastaan. Tarvitaan myös laillisia keinoja tulla EU-alueelle, ja vastuunjakoa EU-maiden kesken."
FIPSU: MEP-ehdokkaiden haastattelu: Tarja Cronberg ja Anneli Jäätteenmäki (http://www.fipsu.com/?x118165=218244) 28.4.2014

Vastuunjaon ja laillisten keinojen lisäämisen puolesta puhuvat poliitikot kertovat harvoin tai paremminkin ei koskaan, mitä heidän vaatimuksensa käytännössä tarkoittavat. Cronbergkin puhuu oikeasti vastaanotettavien pakolaisten (sekä laittomien siirtolaisten) määrän moninkertaistamisesta ja käsittämättömän suurista kustannuksista.

Mitä helpommaksi ulkorajamaista pohjoisen sosiaaliturvavaltioihin pyrkiminen tehdään, sitä houkuttelevammaksi koko Eurooppa muuttuu, ja sitä enemmän paineita kohdistuu myös ulkorajamaihin. Tätä noidankehää ei voi purkaa maahanmuuttoa helpottamalla tai resursseja loputtomiin lisäämällä.

Minä en kyllä ymmärrä noiden vihreiden ajatuksia, ensin ne selittävät suomalaisten suuresta hiilijalanjäljestä ja kauheasta luonnonvarojen tuhlauksesta ja sitten ne haluavat päästää lukemattomat kehitysmaalaiset kasvattamaan hiilijalanjälkeään monikymmenkertaiseksi ja tuhlaamaan luonnonvaroja Eurooppaan ja Suomeen. :facepalm:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Reinhardt42 - 29.04.2014, 12:36:21
Tämä on koko Homman kylmäävin ketju. Aina kun tähän tulee jotain uutta ja varsinkin kun kirjoittajana on Roope, tunnen jonkinasteista jännitystä ja kauhua siitä että ovatko sekopäiset EU-mokuttajat saaneet jonkin ratkaisevan askeleen otettua tämän CEAS-helvetinkoneen lopulliseksi käynnistämiseksi.
Kyseinen projekti nimittäin on ehdottomasti tärkein yksittäinen tekijä kaikkea maahanmuuttopolitiikkaa koskien.
Meikäläiset tämänhetkiset vallanpitäjämme nimittäin eivät tule laittamaan tikkua ristiin projektin läpiviennin estämiseksi, vaan uskoakseni jopa toivovat että se vihdoin toteutuisi. Se antaisi heille kauan kaipaamansa mahdollisuuden nostaa kätensä pystyyn koko kiperän maahanmuuttokysymyksen edessä antaen jälleen tilaisuuden piiloutua EU:n selän taakse.
Suosituimpina selityksinä toimittajien kysymyksiin joita ei koskaan esitettäisi olisivat: näin on EUssa yhdessä päätetty, EU:han maksaa suurimman osan kustannuksista joten me tienataan täl, meidän pitää kantaa osamme vastuusta ja että Suomen pitää mukautua muuttuvan maailman haasteisiin avoimin mielin ym. jo tähänkin asti kuultua raivostuttavaa paskaa.
En usko että koko CEAS etenee mihinkään ennen eurovaaleja mutta pahoin pelkään että riippuen vaalin tuloksesta, mokuttajat kokevat rakastamansa hankkeen läpiviennin aikaikkunan kuluvan umpeen, ja alkavat hääräillä tosissaan sen toteutumiseksi viimeinkin. Näyttöä nimittäin on että kun tahtoa löytyy niin EU onnistuu tekemään ja toteuttamaan päätöksiään nopeastikin, tukipakettien osalta toimittiin reippaasti ja luovasti lennosta kun oli isojen sikojen bileet uhattuina.
Koko CEAS:n historiahan on ollut pelkkää salailua ja sammutetuin lyhdyin ajamista ja lehdistöä ei ole kiinnostanut tai se on ollut tarkoituksella hiljaa, kenties jopa tiettyjen tahojen vaatimuksesta. Korkeintaan jotain haastatteluissa juuri em. Cronbergin tyyliin mainittuja kauniita yleisen tason maalailuja sivulauseissa.
Tämä on Suomen kannalta ratkaisevan tärkeä asia noin niin kuin kansallismielisestä ja vähän muustakin näkökulmasta nimittäin CEAS yhdistettynä liittovaltioon ja Välimeren jo vuotavien tulvaportttien avaamiseen, jotka molemmat ovat myös eurofiilien ja mokuporukoitten intresseissä toteutuessaan tuhoavat tuntemamme Suomen. kaikki talousnäkökulmat ovat täysin toisarvoisia nyt ja varsinkin mutavyöryn jälkeen ja ne ehtii hoitaa myöhemminkin, mutta se ei onnistu mikäli talon asukkailla on kädet sidoittuina ja mökki piippua myöten täynnä paskaa.
Juuri siksi on äärimmäisen tärkeää äänestää mahdollisimman avoimesti mokukriittistä ehdokasta kohdennetusti, eli Jussia  ;D.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Maisteri Vihannes - 29.04.2014, 12:41:17
Mitä CEASin voimaantulo vaatii? Komission esitys ja puoltava äänestystulos europarlamentissa, ja se oli sitten siinä?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.04.2014, 13:23:18
Mitä CEASin voimaantulo vaatii? Komission esitys ja puoltava äänestystulos europarlamentissa, ja se oli sitten siinä?

Käsittääkseni tärkeimmistä kysymyksistä päätettäisiin Eurooppa-neuvostossa määräenemmistöllä. Jos Saksa hyväksyy suunnitelmat, niin se on luultavasti aika pitkälle siinä.

CEAS on oikeastaan ollut olemassa jo vuosia ja etenee ensi kaudella kolmanteen vaiheeseensa. Nyt on enää kyse siitä, millä aikataululla CEAS hivutetaan siihen pisteeseen, että voidaan oikeasti puhua sellaisesta yhteisestä keskitetystä turvapaikkajärjestelmästä, joka on ollut vaiheittain etenevän projektin tavoitteena.

Juna etenee, vaikka ei europarlamentin ja komissaarien toivomalla vauhdilla. Näin vaalien alla CEASia eteenpäin puskevat poliitikot ovat ymmärrettävästi haluttomia kertomaan ensi kauden juonistaan. Esimerkiksi Suomessahan kaikki eduskuntapuolueet perussuomalaisia ja kristillisdemokraatteja lukuun ottamatta kannattavat yhteistä turvapaikkapolitiikkaa, mutta vaikenevat yhteisen politiikan seurauksista Suomelle ja Euroopalle. Vaalien jälkeen näkyvyys ehkä taas paranee.

Lainaus
The first phase of the CEAS was completed in 2006 under the Hague Program (2004-2009). The system includes three directives and one regulation. These instruments are currently under review and the European Commission has proposed improvements and modifications in four “recast proposals” that should be agreed by 2012.
ECRE: From Schengen to Stockholm, a history of the CEAS (http://www.ecre.org/topics/areas-of-work/introduction/194.html)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Maisteri Vihannes - 29.04.2014, 13:49:23
Esimerkiksi Suomessahan kaikki eduskuntapuolueet perussuomalaisia ja kristillisdemokraatteja lukuun ottamatta kannattavat yhteistä turvapaikkapolitiikkaa,

Eikai tuo kristillistenkään vastustus varmaa ole, vai ovatko selventäneet kantaansa.

Räsänen ei ota kantaa taakanjakoon, eikä täsmennä, mitä yhteisen turvapaikkajärjestelmän ominaisuuksia Suomi mahdollisesti ei hyväksyisi. Ilmeisesti ainakin taakanjako on Räsäselle ok, koska hän ilmoittaa hyväksyvänsä muutosehdotukset, joista taakanjako on ollut vuosikausia yksi tärkeimmistä.

Lainaus
ECRE: From Schengen to Stockholm, a history of the CEAS (http://www.ecre.org/topics/areas-of-work/introduction/194.html)

Tuossa historiikissa mainitaan CEAS ratkaisuna turvapaikkashoppailuun, ehkä se ei ole shoppailua jos tulijat ohjataan tänne automaattisesti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.04.2014, 14:15:54
Esimerkiksi Suomessahan kaikki eduskuntapuolueet perussuomalaisia ja kristillisdemokraatteja lukuun ottamatta kannattavat yhteistä turvapaikkapolitiikkaa,

Eikai tuo kristillistenkään vastustus varmaa ole, vai ovatko selventäneet kantaansa.

Joku voisi kysäistä. Vielä viime eurovaalien aikaan ilmoitettu kanta oli yhteisen turvapaikkapolitiikan vastainen, mutta hallitukseen menon jälkeen siihen ei ole tietääkseni otettu kantaa. Uudessa vaaliohjelmassa asiaa ei mainita lainkaan, ja ainakin minä olen tulkinnut sisäministeri Räsäsen kannanotot yhteistä turvapaikkapolitiikkaa kannattaviksi tai vähintäänkin sellaista myötäileviksi.

Keskustan vaaliohjelmassa puolestaan kannatetaan yhteistä turvapaikkapolitiikkaa, mutta vastustetaan turvapaikanhakijoiden jakamista jäsenmaiden kesken, mikä on CEASin kehityksen tuntien osoitus joko suunnattomasta naiiviudesta tai sitten ihan vain äänestäjien narraamisesta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Reinhardt42 - 29.04.2014, 14:41:08
Kepun ja koko konsensuspaskasakin tuntien kyse on harhautuksesta ja hyssyttelystä. Kun koko aiheesta ei puhuta, mediakaan ei kiinnosta eikä kukaan kysy mitään.
Kun CEAS saadaan voimaan ei voi kun nostaa kädet pystyyn ja antaa EU:n määrätä. Kepunkin mepit ovat käyneet sitten kaikessa hiljaisuudessa vetämässä nimet alle kaikkiin mahdollisiin isojen maiden sanelemiin "pakolaisten" loppusijoituspapereihin.
Tämä tietysti on kaikille konsensuspuolueille vain eduksi ja joka ainoa puolue Persuja lukuunottamatta tämän tulee siunaamaan. Kristillisetkin.
Loppuu se iänikuinen jankkaaminen maahanmuuttopolitiikasta. Voidaan sitten ensi kerran vedota aidosti olemassaoleviin "kansainvälisiin sopimuksiin" ja keskittyä viimeinkin perusasioihin kuten omien etujen kähmintään ja virkojen ja suojatöiden jakeluun kavereille ja uusien veronkorotusten suunnitteluun.
Unohtamatta kuitenkaan kansalaisille vittuilua onhävettänytleijonat-tyyliin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.04.2014, 18:27:15
Lainaus
Liberaalipuolueen europarlamentaarikko Cecilia Wikström sanoo, että yksi hänen kärkitavoitteitaan, mikäli tulee uudelleen valituksi europarlamenttiin, on antaa valtavien pakolaisleirien turvapaikanhakijoille turvallinen ja laillinen väylä EU:hun.

[...]

"Minusta on korkea aika ottaa seuraava askel, mitä tulee EU:n turvapaikkapakettiin. Olin pääneuvottelija parlamentissa kun viimein saimme vuonna 2013 aikaan Euroopan Yhteisen Turvapaikkajärjestelmän (CEAS), mutta se perustuu edelleen oletukseen, että kansainväliseen suojeluun oikeutetun on haettava turvapaikkaa Euroopan maaperällä, ennen kuin hakemus voidaan edes rekisteröidä. Toisin sanoen he vaarantavat henkensä ylittäessään Välimeren."

"Siispä meidän on otettava seuraava askel ja mahdollistettava turvapaikan hakeminen pakolaisleireillä ja myös Euroopan suurlähetystöissä ympäri maailmaa taataksemme heille turvallisen ja laillisen väylän EU:hun."

Toisin kuin EU-skeptikot, Liberaalipuolue ja Cecilia Wikström haluavat siirtyä lähemmäksi liittovaltiota. Hän kertoo Radio Swedenille, että "Minä uskallan sanoa f-sanan, eikä se ole mikään kirosana vaan federalismi-sana. Uskon meidän siirtyneen tällä kaudella monin tavoin lähemmäksi liittovaltiota. Federalismi ei tarkoita päätöksenteon siirtämistä ylemmälle tasolle, vaan oikeiden päätösten tekemistä oikealla tasolla. Uskon, että EU-maiden ja sen instituutioiden välistä yhteistyötä on edelleen vahvistettava."  (käännös)
Radio Sweden: Liberal Party:"High time to take the next step on asylum" (http://sverigesradio.se/sida/artikel.aspx?programid=2054&artikel=5847754) 29.9.2014

Haastattelu englanniksi (http://sverigesradio.se/sida/artikel.aspx?programid=2054&artikel=5847754&playaudio=4933318) (7 min)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jari Leino - 03.05.2014, 00:34:22
Ainakin Cecilia Wikström sanoo ihan suoraan ja avoimesti, mitä haluaa.

Se on kunnioitettava piirre poliitikossa.

Pidän Cecilia Wikströmin uudelleenvalintaa hyvin todennäköisenä ja uskon, että hän tulee ajan myötä onnistumaan pyrkimyksissään.

Siksi Suomen ainoa keino pelastua on erota EU:sta mahdollisimman pian.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 03.05.2014, 16:18:24
Lainaus
Yhteinen eurooppalainen turvapaikkajärjestelmä on ollut yksi Suomen EU-prioritee-
teista
Tukholman ohjelman hyväksymisestä lähtien. Suomi on toiminut aktiivisesti tehok-
kaamman ja yhdenmukaisemman sääntelyn edistämiseksi kaikilla turvapaikkajärjestelmän
osa-alueilla ja tukenut puheenjohtajavaltion ponnisteluja turvapaikkajärjestelmää koskevien
EU-säädösten hyväksymiseksi vuoden 2012 määräajassa. Säädökset tulivat hyväksytyiksi
kesäkuussa 2013. Suomi on omalta osaltaan sitoutunut edistämään turvapaikkajärjestel-
mään liittyvän lainsäädännön täytäntöönpanoa ja on eri yhteyksissä korostanut kaikkien
jäsenvaltioiden vastuuta eurooppalaisen turvapaikkajärjestelmän toteuttamisessa. Jäsen-
valtioiden väliseen käytännön yhteistyöhön Suomi on osallistunut aktiivisesti Euroopan
turvapaikka-asioiden tukiviraston, EASO:n johdolla.
Hallituksen vuosikertomus 2013
Osa 4/4: Toimenpiteet eduskunnan lausumien ja kannanottojen johdosta (http://vnk.fi/julkaisukansio/2014/h01_Hallituksen_vuosikertomus_2013/pdf/fi414888.pdf)

Vuosikertomuksessa myös kerrataan, miten nykyinen hallitus on kääntänyt kelkkansa luvattujen turvapaikkapykälien kiristyksien suhteen.

Lainaus
Selvitys oli kesällä 2012 lausuntokierroksella. Järjestöt vastustivat laajalti perheenyhdis-
tämiseen kohdistuvia lisärajoituksia. Suurin osa eduskuntaryhmistä piti myös parhaana
joko pidättäytyä edellytysten kiristyksistä
kokonaan tai ainakin odottaa tarkempaa vaiku-
tusanalyysiä. Selvityksen pohjalta on päädytty tekemään tarkempaa vaikutusarviointia jo
tehtyjen toimenpiteiden (mukaan lukien säädösmuutokset) osalta.

Lainaus
Kansainvälistä suojelua hakeva oleskelee Suomessa laillisesti, mutta aina hake-
muksensa ratkaisemiseen asti kuitenkin väliaikaisesti. Hakija saa osan toimeentulosta ja
huolenpidosta hyödykkeinä vastaanottokeskuksesta, jolloin rahana maksettava osuus on
aina alhaisempi kuin toimeentulotukeen oikeutetulla maassa asuvalla henkilöllä. Haki-
jamäärät ovat pysyneet alhaisella tasolla (runsas 3000 turvapaikanhakijaa / vuosi). Näin
ollen Suomen maahanmuuttoa koskevien säännösten ei voida katsoa muodostuneen veto-
voimatekijäksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 03.05.2014, 20:18:56
Soinin kunniaksi voi kertoa, että hän sanoi pitävänsä  maahanmuuttopolitiikan säilymistä kansallisissa käsissä tärkeänä. Muistaakseni ei kuitenkaan tuonut esiin näitä EU-tason juonia - tai sitten hänen puheensa niistä ei päässyt uutisiin asti.

Vielä kuitenkin ehtii pitämään tätäkin asiaa esillä ennen EP-vaaleja. Toivottavasti edes PS:llä on kanttia siihen. Ennen viime joulua EU:ssa tehtiin päätöksiä hivuttamisen jatkamisesta heti EP-vaalien jälkeen kesäkuussa. 
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 15.05.2014, 00:49:13
Tätä et lukenut Hesarista:

Lainaus
Euroopan unionin siirtolaisuus-, turvapaikka- ja pakolaispolitiikasta saattaa tulla kevään EU-vaalien arvokeskustelun ydin. Tuima katsasti suomalaispuolueiden kannat unionimaihinmuuttoon.

Lähivuosina EU:ssa käytäneen suuri periaatteellinen kiista erityisesti taakanjaoksi kutsutusta prosessista, jolla lievitettäisiin jäsenmaiden välille epätasaisesti jakautuneita turvapaikkahaasteita.

Käytännössä lähes kaikilla mittareilla poikkeuksellisen raskas ”solidaarisuustaakka” lankeaisi ainakin Suomelle, joka saisi nykylukujen valossa käsiteltäväkseen arviolta lähes kolminkertaisen määrän eli kymmenisen tuhatta turvapaikkahakemusta vuodessa (ks. linkki maakohtaisiin tilastoihin jutun lopussa).

Yhteisvastuita arvioitaessa otetaan huomioon muun muassa ulkomaalaisperäisen väestön osuus kussakin EU-maassa ja väestöön suhteutettu turvapaikanhakijoiden vuosittainen määrä. Lisäksi huomioidaan asukastiheys, taloudellinen kantokyky sekä muut sujuvaa käsittelyä puoltavat seikat kuten hyvä hallintotapa.


Vaalien suuriksi menestyjiksi eri puolilla Eurooppaa – ja myös Suomessa – veikataan oikeistosuuntautuneita, kansallismielisiä puolueita. Niiden kannattajia kalvaa erityisesti pelko unionin harmonisoituvan turvapaikkapolitiikan seuraamuksista.

Ohjenuorana Dublin-menettely

Suomen eduskuntapuolueiden EU-vaaliohjelmissa 2014 maahanmuutto-, turvapaikka- ja pakolaisasioiden painoarvot vaihtelevat asialle omistetusta luvusta lakoniseen huomautukseen.

[...]

Juuri FRONTEX on puolestaan Perussuomalaisten mielestä oikea elin pitämään erityisesti Välimeren maiden paisuneet siirtolaistulvat kurissa, jos kansalliset voimavarat eivät siihen riitä. Kokoomuksen ja vihreiden tapaan puolueen EU-vaaliohjelmassa maahanmuutto on saanut kokonaan oman lukunsa, jossa edellytetään muun muassa, että Dublin-menettelystä ei luovuta missään jäsenmaassa edes talouskriisin varjolla. Asetus ehkäisee turvapaikkaturismia.

Taakanjakokysymykseen perussuomalaisilla on selvä kanta: suhtaudumme kriittisesti EU:lle kaavailtuihin solidaarisuusmekanismeihin. EU ei voi missään olosuhteissa päättää, minkä verran ja minkälaista maahanmuuttoa jäsenmaiden tulee vastaanottaa.

Kaikista puolueista vain Perussuomalaiset ovat lisäksi tyytymättömiä myös jäsentymättömään maahanmuuttokeskusteluun, jonka tasoa ja asiapitoisuutta on nostettava.
Turvapaikanhakijat tulilinjalla eurovaaleissa (http://tuima.fi/?p=8206) 14.5.2014

Lainaus
Keväinen hallituksen kehysriihi 2015–2018 arvioi, että uusia turvapaikkahakemuksia jätetään edelleen noin 3500 vuodessa. Suomi ei siis ole ainakaan taloudellisesti varautunut käsittelemään suurempia hakijamääriä.

Euroopan unionissa kasvavat paineet tasata  turvapaikanhakijoita eri jäsenmaiden välillä erilaisin mekanismein (ja tarvittaessa EU-rahoituksella) kuitenkin kohdistuvat väistämättä Suomeen. Suomessa ulkomaalaisperäisen väestön osuus on kaukana Euroopan keskiarvoista, asukastiheys pieni, taloudellinen kantokyky A-luokkaa ja olot kohtalaisen vakaat.

Esimerkiksi Suomeen usein muutoin verrattavat Ruotsi, Tanska, Hollanti ja Itävalta ovat turvapaikkamaina eri suuruusluokassa. On arvioitu, että tasoitus taakanjaossa tarkoittaisi Suomelle noin kymmentä tuhatta turvapaikkahakemusta vuodessa.

Sijainti EU:n pohjoisella reunalla on vaikuttanut Suomen asemaan turvapaikanhakijoiden suosiossa. Vielä hankalammin saavutettavissa oleva Irlanti jää selvästi Suomenkin jälkeen väestöön suhteutettujen hakemusten määrässä. Sama koskee Portugalia, jolta tuskin lähdetään nykyisessä talouskriisissä vaatimaan yhteisvastuita.
Jätetyt turvapaikkahakemukset EU-maissa 2013 (http://tuima.fi/?p=8215) 14.5.2014

Lainaus
Tuima.fi on HAAGA-HELIAN toimittajaopiskelijoiden verkkolehti
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 05.06.2014, 15:38:06
Lainaus
Turvapaikkasäännösten yhtenäistäminen etenee: Määritelmädirektiivi voimaan

Valtioneuvosto esitti tänään, että tasavallan presidentti vahvistaisi ulkomaalaislain muutoksen. Muutos liittyy määritelmädirektiiviin ja sen täsmentämiseen, ketkä voivat saada kansainvälistä suojelua EU-maissa ja millaisia etuuksia suojelua saaville henkilöille myönnetään.

Määritelmädirektiivin taustalla on Euroopan parlamentin ja neuvoston direktiivi vaatimuksista kolmansien maiden kansalaisten ja kansalaisuudettomien henkilöiden määrittelemiseksi kansainvälistä suojelua saaviksi henkilöiksi, pakolaisten ja henkilöiden, jotka voivat saada toissijaista suojelua, yhdenmukaiselle asemalle sekä myönnetyn suojelun sisällölle.

Lakiin ehdotetut täsmennykset parantaisivat päätöksenteon läpinäkyvyyttä ja kansainvälistä suojelua hakevien yhdenvertaista kohtelua.

Lainmuutoksen tavoitteena on myös vahvistaa pyrkimystä luoda uudelleen yhteys Suomeen ilman huoltajaa saapuneen alaikäisen ja hänen ulkomailla oleskelevan vanhempansa välille. Maahanmuuttovirasto suorittaa tällaista alaikäisen turvapaikanhakijan huoltajan jäljittämistä jo nyt, mutta jatkossa jäljittämistä jatkettaisiin tarpeen mukaan vielä sen jälkeen, kun alaikäiselle on myönnetty kansainvälistä suojelua.

Lain muutos tulee voimaan 1.7.2014.

Valtioneuvosto (http://valtioneuvosto.fi/ajankohtaista/tiedotteet/tiedote/fi.jsp?oid=417675)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: falco - 16.06.2014, 18:52:19

Lainaus
Tuima.fi on HAAGA-HELIAN toimittajaopiskelijoiden verkkolehti

Tuima.fi:n kirjoittama juttu aiheesta oli varsin selkeäsanainen, tosin lyhyt kuvaus tilanteesta. Minua suorastaan järkyttää, että Haaga-Helian toimittajaopiskelijat kykenevät tuottamaan tästä tärkeästä aiheesta laadukkaamman journalistisemman tuotoksen kuin valtamedia. Samalla itkettää, koska eihän kukaan tuota Tuiman tekstiä löydä luettavakseen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.06.2014, 05:33:54
Lainaus
EU should share out refugees rescued at sea - UNHCR

European Union countries should help Italy absorb the huge number of migrants arriving by boat from North Africa, by agreeing to take in people rescued in international waters, a U.N. refugee agency spokeswoman said on Friday.

The EU law governing asylum seekers - the Dublin Regulation - requires the country where a person first arrives to handle their application, putting extra pressure on countries, like Italy, on the EU's outer edge to take in migrants.

But those rescued in international waters could be taken in by any EU country, perhaps according to a negotiated quota system, said Carlotta Sami, southern Europe's spokeswoman for the U.N. High Commissioner for Refugees (UNHCR).

"This is particularly needed in the case of Syrians, but could be also (done) for other nationalities that in this moment represent very vulnerable groups," she told Reuters.

Last year, the majority of the more than 40,000 migrants who reached Italy by sea were fleeing Syria's civil war and Eritrea's harsh military service. Most of the 366 people who drowned in a shipwreck off Sicily in October were Eritrean.

So far this year, more than 50,000 people have been rescued by Italy's navy and coastguard, more that reached Italy in the whole of 2013, and the number is set to exceed the 62,000 who came in 2011, at the height of the "Arab Spring" uprisings.

"Asylum claims could be processed jointly by several EU member states, and this could be followed by an assignment of quotas among different states that could host and receive a certain number of refugees," Sami said.

Asylum requests to EU members rose more than 30 percent last year, with Germany receiving almost 110,000, more than any other country in the world, according to the UNHCR.

On Friday, Germany agreed to take in an additional 10,000 Syrians this year through resettlement, doubling its original offer, far more than any other European nation.

About two-thirds of those who arrive in Italy move on to other EU countries but, because of the Dublin Regulation, often are sent back to Italy, where they cannot find jobs or housing.

Italy's economy has shrunk by more than 9 percent since 2007 and unemployment has soared to levels last seen in the 1970s.
Reuters (http://uk.reuters.com/article/2014/06/13/uk-italy-migrants-idUKKBN0EO1QA20140613) 13.6.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Finka - 18.06.2014, 07:50:49
Miksi hakemukset pitäisi jakaa juuri EU-maiden kesken? Kansainvälisiltä vesiltä löydetyn turvapaikkahakemuksen voisi käsitellä mikä tahansa maa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Juffe - 18.06.2014, 08:56:38
Lainaus
EU should share out refugees rescued at sea - UNHCR

About two-thirds of those who arrive in Italy move on to other EU countries but, because of the Dublin Regulation, often are sent back to Italy, where they cannot find jobs or housing.
Reuters (http://uk.reuters.com/article/2014/06/13/uk-italy-migrants-idUKKBN0EO1QA20140613) 13.6.2014
Millä tavalla muuten työpaikkojen saatavuus ja asuntotilanne on ongelma täsä asiassa? Eivätkö hakijat kuitenkin ole vapaita muuttamaan toisiin EU-maihin työnhakuun turvapaikan myöntämisen jälkeen? Dublin-sopimushan tarkoittaa, että turvapaikan käsittelyprosessi suoritetaan saapumismaissa.

Tuli mieleen, että vaikka yhteinen turvapaikkajärjestelmä toteutuisi, olisko siitä Suomella aiheutuva katastrofi kuitenkin vältettävissä Suomen omin toimin? Siis nopeuttamalla käsittelyaikoja ja karsimalla valituskierroksia, varmistamalla, että hylkäykset johtavat palautuksiin, pitämällä perheenyhdistämiset minimissä ja viimekädessä jopa (ulkomaalaisten) asumiseen perustuvien etujen karsimisella? Johtaisiko tämä siihen, että hakijamäärän moninkertaistumisesta huolimatta pysyvästi maahan jäävien määrä ei räjähtäisi?
(Teoriassa tietenkin siis, käytännössä ei hallintovallalta varmaankaan löytyisi järkeä ja munaa tällaiseen jos sitä ei löydy CEAS:n torjumiseenkaan. Ellei sitten hakijamäärien äkkinousu aiheuttaisi kansassa jotakin shokkireaktiota, joka pakottaisi toimiin.)

Edit: kanssa => kansassa
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 18.06.2014, 09:05:12
Kuten on tullut mainittua: talvi kyllä hoitaa rikastajaongelman kunhan vain hoidetaan homma. Sosiaaliapu ja terveydenhoito vakuutusperusteiseksi, julkiset kämpät pisteytyksen taakse jne. Pikaiset karkotukset edes joissakin tapauksissa toisivat myös mainetta rahantarvitsijoiden joukkoon.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Juffe - 18.06.2014, 10:23:45
Aiheeseen yleisesti liittyen:
Osaisiko joku kertoa tiivistetysti, mitä kaikkia periaatteellisia ja käytännön ongelmia yhteiseen turvapaikkajärjestelmään liittyy? Itselläni ei nimittäin ole valmista listaa mielessäni.
On toki selvää, että siitä aiheutuu Suomelle hurja lisätaakka. Mutta tämä tietysti on taakanjaon idea. Mitkä ovat ne syyt, joiden vuoksi tällainen taakanjako ei ole hyväksyttävää?

Kuvitellaan vaikkapa seuraavanlainen keskustelu:
Minä: "CEAS moninkertaistaa Suomen maahanmuutto-ongelmat."
Vastapuoli: "Totta. Mutta näitä tulijoita saapuu Eurooppaan joka tapauksessa, ja jollekin se taakka kuitenkin lankeaa. Tulijat ovat pyrkimässä Eurooppaan, koska täällä on paremmat olot. Mielestäni on kohtuutonta, että maantieteellisistä syistä kätevimmät saapumismaat joutuvat kantamaan taakan, joka johtuu Euroopan yleisestä vetovoimasta. Kyllähän se sattuu, mutta meidän kipumme vähentää Italian, Kreikan yms. kipua, joka kuitenkin johtuu osittain myös meidän vetovoimastamme. On itsekästä pitää kiinni maantieteellisestä eristyneisyydestämme johtuvasta suojatusta asemastamme." 
Mitä tähän kannattaa vastata?

Olisin iloinen, jos osaisin vastata muutakin kuin "haitat vain ovat niin suuret, että en halua niitä kantaa jos vain suinkin voin sen välttää, ja paskat noista muista EU-maista." Vähemmän itsekkäältä kuulostavia argumentteja tietääkseni on, mutta eivät palaudu muistiini.

Periaatteessa kannatan taakanjakoa, kun kyse on Suomeen saapuvista humanitaarisista maahantulijoista. Olisi mielestäni hyvä, jos rasite jakautuisi tasaisesti ympäri Suomea. Käytännössä en kuitenkaan kannata tätä, koska itse systeemissä on mätää ja tökkivä vastaanotto toimii signaalina päättäjille, että tulijamäärää on syytä hillitä. Liittyykö CEAS:iin esim. samanlaista ilmiötä?


Edit: Kiitokset Roopelle.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.06.2014, 15:18:23
Aiheeseen yleisesti liittyen:
Osaisiko joku kertoa tiivistetysti, mitä kaikkia periaatteellisia ja käytännön ongelmia yhteiseen turvapaikkajärjestelmään liittyy? Itselläni ei nimittäin ole valmista listaa mielessäni.
On toki selvää, että siitä aiheutuu Suomelle hurja lisätaakka. Mutta tämä tietysti on taakanjaon idea. Mitkä ovat ne syyt, joiden vuoksi tällainen taakanjako ei ole hyväksyttävää?

Ensinnäkin EU:n yhteinen turvapaikkajärjestelmä ja kiintiöt johtaisivat tulijamäärän moninkertaistumiseen sekä koko EU:n alueella että tietenkin vielä enemmän Suomessa. Ei yksinkertaisesti pidä paikkaansa, että "tulijoita saapuu Eurooppaan joka tapauksessa", koska ulkorajavaltioilla on vielä toistaiseksi kannuste valvoa rajojaan ja minimoida turvapaikanhakijoiden ja laittomien siirtolaisten määrä. Reunavaltiot (mm. Italia, Kreikka, Bulgaria) saavat nykyään jatkuvasti noottia rajavalvonnan tiukkuudesta ja turvapaikkajärjestelmiensä puutteista. Nämä reunavaltioiden ongelmat ratkeaisivat EU:n yhteisessä turvapaikkajärjestelmässä, kun ne vain nostaisivat kädet pystyyn, avaisivat rajaportit selälleen ja siirtäisivät tulijat saman tien muualle Eurooppaan. Silloin puhuttaisiin miljoonista Eurooppaan pyrkijöistä, kun nyt tulemista rajoittaa rajavaltioiden nuivuus ja ihmissalakuljettajien korkea kynnysraha (Suomeen ja Ruotsiin keskimäärin kymppitonni).

Tulijoiden määrään vaikutetaan maahanmuuttopolitiikalla. Kansallinen maahanmuuttopolitiikka olisi useimmissa tapauksissa tiukempaa, koska hallituksia pidetään suoraan vastuullisina tulijamääristä. Europarlamentti sen sijaan on ilmaissut olevansa maahanmuuton suhteen erittäin liberaali. Parlamentille ei olisi mikään temppu määrätä esimerkiksi 100 000 kiintiöpakolaista jaettavaksi vuosittain jäsenmaiden kesken, päättää ns. tilapäisen suojelun direktiivin aktivoimista vastaavista toimista, jotka takaisivat välittömät oleskeluluvat kaikille EU-alueelle saapuville syyrialaisille, tai perustaa turvapaikanhakutoimistoja EU-edustustoihin ja maailman kriisipesäkkeisiin. Euroopan pakolaisongelmathan olisi jo "ratkaistu", ja esimerkiksi Suomeen mahtuisi esillä olleiden taakanjakolaskentakaavojen (http://hommaforum.org/index.php?topic=27433.msg580770#msg580770) mukaan yli 60 miljoonaa ihmistä. Päättäjät ja lobbaajat pidettäisiin tyytyväisinä miljardien eurojen pakolaisrahastokorvauksilla, jotka edellyttäisivät joko jäsenmaiden maksujen korotuksia tai EU:n verotusoikeutta. Kuvio on tuttu pienemmässä mittakaavassa Suomesta, kun hallitus on vastannut eurooppalaisittain ääriliberaalista pakolaispolitiikasta johtuvaan kuntapaikkapulaan kaksinkertaistamalla valtion maksamat kuntapaikkakorvaukset ja kasvattamalla pakolaiskiintiötä.

CEAS kiintiöineen ei olisi ratkaisu muuhun kuin EU-kansalaisten tahdon ohittamiseen ja liittovaltiokehityksen tehokkaaseen edistämiseen. Kaikessa muussa se olisi katastrofi muille paitsi paatuneimmille federalisteille ja järjestelmästä taloudellisesti hyötyville. Liittovaltiota jarruttavat jäsenmaissa maahanmuuttokriittiset voimat, joiden poliittinen vipuvoima perustuu sisäpoliittiseen pelotteeseen ja uskottavuuteen maahanmuuttopolitiikassa. Kun maahanmuuttopolitiikan päätösvalta siirrettäisiin Brysseliin ja luotaisiin valtava EU:n laajuinen rahaa nielevä ja syytävä byrokratiakoneisto turvapaikanhakijoiden siirtelyyn, ei kriittisille voimille jäisi enää paljon puolustettavaa eikä keinoja puolustamiseen.

Yhteisen turvapaikkajärjestelmän sijaan kannatan yhtenäistä turvapaikkapolitiikkaa silloin, kun se on järkevää ja jäsenmaiden etujen mukaista. Kaikki maahanmuuttopolitiikan ratkaisut eivät mitenkään sovi samalla lailla kaikille jäsenmaille, mutta on löydettävissä yhteistyömahdollisuuksia esimerkiksi hylättyjen turvapaikanhakijoiden ja laittomien siirtolaisten palautusten järjestämisessä. Samoin palautussopimukset olisi järkevää neuvotella koko EU:n laajuisesti.

Eurooppalaiseen turvapaikkapolitiikkaan liittyy kaksinaismoraali. Toisaalta pidetään täysin kyseenalaistamatta kaikkine seurauksineenkin kiinni maailman miljardien ihmisten idealisoidusta oikeudesta saapua vapaasti Eurooppaan hakemaan turvapaikkaa, vaikka ei olisi siihen edes oikeutettu. Toisaalta haluttuun maahan tuleminen tehdään hankalaksi muun muassa rajavalvonnan keinoin. Tämä sitten johtaa osaltaan ihmissalakuljetukseen ja tuhansien eurojen kynnysrahaan, joka pitää tulijamäärät edes jotenkin aisoissa. CEAS kiintiöineen poistaisi kynnysrahan, mikä taas houkuttelisi liikkeelle miljoonat köyhät ja tekisi lopun nykyisenlaisista Euroopasta. Vastaus ei siksi voi olla turvapaikanhakijoiden houkuttelu ja asuttaminen Eurooppaan, vaan kaksinaismoraalista luopuminen ja sen myöntäminen, että turvapaikkaideaali on nykyisenlaisena epärealistinen. Mikäli kuitenkin tämän ideaalin ytimestä halutaan pitää edelleen kiinni, on suojaa tarvitsevat turvapaikanhakijat asutettava vastaisuudessa turvallisiin maihin Euroopan ulkopuolelle. Tässä olisi EU:n laajuisen yhteistyön paikka.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.06.2014, 12:25:37
Lainaus
By Elizabeth Collett

In a context of economic crisis and slow recovery, broad euroscepticism, and a tense public debate about the scale of immigration flows to Europe, the European Union has embarked on a process of articulating the next stage of EU immigration and asylum policy development. EU policymakers are doing this at a time when very real crises, requiring urgent attention, are taking place at the southern borders of Europe. The Syrian conflict has left millions displaced, and the number of those embarking on dangerous journeys across the Mediterranean has held distressingly firm.

In June 2014, the European Council must articulate a set of long-term objectives and priorities for action, while contending with these short-term pressures. The Council must do this at a time when the recent experience of policy promulgation has been difficult, and the inspiration and enthusiasm for new policy is largely absent. This MPI Europe policy brief, the first of three on EU immigration and asylum policy, sets out the reasons for increasingly sclerotic policy development, and why policy will be harder to make in the future. It highlights that these challenges will not subside in the future, but EU institutions and Member State governments will have to find different ways of working together to identify common solutions based on the real future needs of Member States, and by focusing on adding value to existing immigration systems.
Migration Policy Institute (http://www.migrationpolicy.org/research/future-eu-policy-development-immigration-and-asylum-understanding-challenge)

Lainaus
Table of Contents

I. Introduction

II. Lessons Learned So Far

A. From Tampere to Stockholm

B. Disappointing Stockholm

III. Looming Challenges

IV. Looking Forward

V. A Framework for New Policy Development
MPI: Future EU Policy Development on Immigration and Asylum: Understanding the Challenge (http://www.migrationpolicy.org/sites/default/files/styles/leftsidebox_image/public/pub_covers/coverthumb-MPIE-Post-Stockholm-Brief1.jpg?itok=GLZ2Sat2) (pdf, 12 sivua)

Lainaus
It has become increasingly clear that the disruptions that
have plagued the Stockholm Programme will not only
continue but are likely to become more entrenched. These
crises have also revealed major drawbacks with the policy
frameworks that have been developed to date
.

This is clearest with respect to the CEAS. Despite hav-
ing negotiated a series of reforms to formally ‘complete’
the CEAS, it is clear that the ever more urgent Syria cri-
sis will require policymakers to return to what have be-
come polarised and intractable issues. It is difficult to find
a policymaker who does not, at least privately, admit the
dysfunctional nature of elements of the CEAS and the per-
verse outcomes it engenders.
For example, with the advent
of Eurodac (the database for identifying asylum seekers
and irregular border crossers), officials at Europe’s exter-
nal borders may have an incentive not to fingerprint upon
arrival, for fear the identification may later be used to re-
turn individuals back to the first country of entry under
the Dublin Convention
; the same holds for asylum seekers
who may have a specific destination in mind. But the very
different perspectives (and motivations) of the various ac-
tors have led to a stand-off with respect to further coop-
eration on asylum, with ‘solidarity’ and ‘burden-sharing’
now more emblematic of a broken debate than substantive
concepts in themselves
.

Lainaus
First, programming in five-year increments sets its sights
primarily on the near term and turns its back to the oppor-
tunity to frame a long-term vision for common EU policy.
One of the key advantages of Tampere was the fact that it
was able to articulate a long-term vision and then combine
it with a set of shorter-term goals designed to make prog-
ress toward that vision. This aspect of JHA programming
has been lost in the flurry of primarily instrumental goals
and reflexive reactions to internal and external challenges.
A case in point: the Stockholm Programme set out a series
of action points without even articulating its ambitions
.
Such instrumentalism may be understandable in that find-
ing common ground on an ambitious agenda would have
been very difficult, hence the choice to focus on smaller,
more incremental, steps. Yet, such choices merely post-
pone the more important conversations that must be had
on such critical issues as burden-sharing and solidarity
concepts whose meaning has degraded to the point of near
empty rhetoric—or establishing the ‘end game’ for com-
mon immigration policy and the CEAS.

Collett ei nähtävästi ymmärrä, että pitkän aikavälin visioista vaikeneminen on ollut täysin tietoista politiikkaa, jonka muun muassa maahanmuuttokomissaari Cecilia Malmström on myöntänyt. Uudistuksia tehdään pieni pala kerrallaan ("alaikäisten" turvapaikanhakijoiden Dublin-palautuksien lopettaminen => Dublin-sopimuksen purkaminen => jäsenmaiden turvapaikanhakijakiintiöt) juuri siksi, ettei niihin päästäisi poliittisesti puuttumaan, vaan CEASiin johtavat palaset loksahtelevat paikoilleen julkisuudelta pimennossa virkamiestyönä. Malmströmin mielestä tuskastuttavan hitaasti, mutta sitäkin varmemmin.

Suuri visio yhteisestä turvapaikkajärjestelmästä ja maahanmuuttopolitiikasta jää ehkä artikuloimatta Tukholman ohjelmassa, mutta se löytyy helposti EU:n maahanmuuttopolitiikkaa ohjaavien poliitikkojen haastatteluista ja kirjoituksista. On löytynyt jo vuosikymmenet, mutta nyt sen suhteen vain ollaan häveliäämpiä, kun visionääreillä on vihdoinkin poliittisia vastavoimia sekä europarlamentissa että etenkin kansallisella tasolla.

Lainaus
Every single migration policy
development of the past 15 years has been hard fought,
and the efforts with respect to the bundle of asylum leg-
islation suggest that reform is even more hard fought, and
does not necessarily lead to substantive improvement. In
addition, the dogmatic imperative driving the creation of
common immigration and asylum policy, combined with
strong nationalistic tendencies within some key Member
States, inhibits the ability of the European Commission to
objectively assess and reform policy, and even admit when
policy is not functioning as expected and rescind
. The
postponement of any serious reform of the Family Reuni-
fication Directive, driven in part by the spectre of Dutch
ambition to increase integration requirements, is one ex-
ample of the difficulties facing a still-maturing policy area
that is frequently overwhelmed by politics. Thus less ef-
fective policy remains on the books and undermines future
development. A key example of this is the development
of economic migration policies since 2005. A consensus
has emerged that the effort to create common standards
by category of migrant—high-skilled, seasonal, etc.—was
wrong-headed. Yet there is no suggestion that an alterna-
tive approach might be considered.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ike60 - 28.06.2014, 13:14:03
Collett ei nähtävästi ymmärrä, että pitkän aikavälin visioista vaikeneminen on ollut täysin tietoista politiikkaa, jonka muun muassa maahanmuuttokomissaari Cecilia Malmström on myöntänyt. Uudistuksia tehdään pieni pala kerrallaan ("alaikäisten" turvapaikanhakijoiden Dublin-palautuksien lopettaminen => Dublin-sopimuksen purkaminen => jäsenmaiden turvapaikanhakijakiintiöt) juuri siksi, ettei niihin päästäisi poliittisesti puuttumaan, vaan CEASiin johtavat palaset loksahtelevat paikoilleen julkisuudelta pimennossa virkamiestyönä. Malmströmin mielestä tuskastuttavan hitaasti, mutta sitäkin varmemmin.

Suuri visio yhteisestä turvapaikkajärjestelmästä ja maahanmuuttopolitiikasta jää ehkä artikuloimatta Tukholman ohjelmassa, mutta se löytyy helposti EU:n maahanmuuttopolitiikkaa ohjaavien poliitikkojen haastatteluista ja kirjoituksista. On löytynyt jo vuosikymmenet, mutta nyt sen suhteen vain ollaan häveliäämpiä, kun visionääreillä on vihdoinkin poliittisia vastavoimia sekä europarlamentissa että etenkin kansallisella tasolla.

Millä tavoin johtavat virkamiehet ajavat CEASia eteenpäin? Antavatko he alemmille virkamiehille uusia ohjeita/määräyksiä jotka käytännössä johtavat haluttuihin tuloksiin? Antavatko he olemassaolevien säädösten tulkintaohjeita, jotka saavat aikaan saman tuloksen?

Käsittääkseni Suomen viranomaiset toimivat noin ennen vuoden 2009 ulkomaalaislain uudistusta. Uudistustahan perusteltiin sillä, että tehtävät lakimuutokset vain kirjasivat lakiin jo yleisiksi käytännöiksi muuttuneet toimintatavat.

Millä tavoin poliittiset luottamushenkilöt - esimerkiksi europarlamentaarikot - voivat puuttua tuollaiseen virkakoneiston osien omavaltaiseen toimintaan?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.06.2014, 13:27:46
Millä tavoin johtavat virkamiehet ajavat CEASia eteenpäin? Antavatko he alemmille virkamiehille uusia ohjeita/määräyksiä jotka käytännössä johtavat haluttuihin tuloksiin? Antavatko he olemassaolevien säädösten tulkintaohjeita, jotka saavat aikaan saman tuloksen?

Näkyvyys on nolla. Kuulemme vasta valmiista päätöksistä. Vielä pahemmaksi tämä muuttuu yleisemminkin Suomessa, jossa EU-määräykset ylittävää toteutuksen tasoa perustellaan käyttämällä tekosyynä EU-määräyksiä.

Millä tavoin poliittiset luottamushenkilöt - esimerkiksi europarlamentaarikot - voivat puuttua tuollaiseen virkakoneiston osien omavaltaiseen toimintaan?

Sanopa se. Ja onko esimerkiksi maahanmuuttokomissaari Malmström omavaltainen runnoessaan läpi kaikkien jäsenmaiden ilmaisemalle tahdolle vastakkaista (http://hommaforum.org/index.php?topic=94467.msg1651654#msg1651654) agendaa vai käyttääkö hän vain saamaansa valtaa, kuten oikein on? Entä hänen alaisensa virkamiehet? Europarlamenttihan on aika pitkälle ääriliberaalin Malmströmin linjoilla toisin kuin itse jäsenmaat.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: hakare - 28.06.2014, 14:43:14
Välillä joutuu kysymään itseltään, ratkeaako pakolaisongelma pakolaisia tasaamalla. No ei ratkea, vaan pahenee. Niin kauan kuin maailman väestön liikakasvua ei pysäytetä, ei myöskään pakolaisongelma ratkea. Muun väittäminen on suurta älyllistä epärehellisyyttä.

Onko lopullinen ratkaisu ebola (tai vastaava virus kuten eläinpopulaatioissa) vai neutronipommi, jää nähtäväksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 04.07.2014, 17:28:11
Ruotsin vierailullaan pääministeri Stubb otti kantaa turvapaikka- ja pakolaispolitiikkaan.

Lainaus
Hän käsitteli myös sitä, mitä Suomi voi tehdä ja korosti, että on tärkeää, että turvapaikka- ja pakolaispolitiikan suhteen keskustellaan siitä, kuinka pakolaistaakka voidaan jakaa "koko Euroopan kesken"(käännös)
Hbl: Stubb om flyktingarna: hemskt och orättvist (http://hbl.fi/nyheter/2014-07-04/627326/stubb-om-flyktingarna-hemskt-och-orattvist) 4.7.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 04.07.2014, 17:59:44
Jaha. Stubin mielestä pakolaiset ovat tällä kertaa taakka. Ja taakka muuttuu rikkaudeksi ja voimavaraksi missä vaiheessa? Siinäkö vaiheessa kun Suomalia saa lisää ulkomaanvelkaa?

Samse! Taikaseinä sulkeudu!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tosiasiallinen Nuiva - 04.07.2014, 18:07:57
Ruotsin vierailullaan pääministeri Stubb otti kantaa turvapaikka- ja pakolaispolitiikkaan.

Lainaus
Hän käsitteli myös sitä, mitä Suomi voi tehdä ja korosti, että on tärkeää, että turvapaikka- ja pakolaispolitiikan suhteen keskustellaan siitä, kuinka pakolaistaakka voidaan jakaa "koko Euroopan kesken"(käännös)
Hbl: Stubb om flyktingarna: hemskt och orättvist (http://hbl.fi/nyheter/2014-07-04/627326/stubb-om-flyktingarna-hemskt-och-orattvist) 4.7.2014

Retorinen kysymys: Miksi YLE ja muu suomenkielinen valtamedia ei kerro sanallakaan tästä Stubbin hankkeesta ja pakolaisten uudelleen brändäämisestä taakaksi? :roll:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 05.07.2014, 14:17:05
Lainaus
...Italian puolivuotiskausi neuvoston johdossa suuntaa myös katseet Välimerelle ja siirtolais- ja turvapaikanhakijoihin. Vaikka edellinen puheenjohtajamaa Kreikka oli saman meren äärellä, eivät nämä kysymykset nousseet vielä keväällä vahvasti esiin. Nyt on odotettavissa toisenlainen linja. Viikoittaiset uutiset mereen hukkuneista tai laivoihin tukehtuneista ihmisistä ovat järkyttäviä, ja YK:n pakolaisjärjestö UNCHR arvioi 500 ihmisen menehtyneen Välimerellä tänä vuonna. Yksimielisyyttä uusista eurooppalaisista turvapaikkakäytännöistä ja etenkään niin sanotusta taakanjaosta ei kuitenkaan ole näköpiirissä.
...

Eurooppatiedotus (http://www.eurooppatiedotus.fi/Public/default.aspx?contentid=309159&contentlan=1&culture=fi-FI#.U7fdL7EfNsw)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: orientexpressen - 05.07.2014, 14:46:23
Lainaus
...Italian puolivuotiskausi neuvoston johdossa suuntaa myös katseet Välimerelle ja siirtolais- ja turvapaikanhakijoihin. Vaikka edellinen puheenjohtajamaa Kreikka oli saman meren äärellä, eivät nämä kysymykset nousseet vielä keväällä vahvasti esiin. Nyt on odotettavissa toisenlainen linja. Viikoittaiset uutiset mereen hukkuneista tai laivoihin tukehtuneista ihmisistä ovat järkyttäviä, ja YK:n pakolaisjärjestö UNCHR arvioi 500 ihmisen menehtyneen Välimerellä tänä vuonna. Yksimielisyyttä uusista eurooppalaisista turvapaikkakäytännöistä ja etenkään niin sanotusta taakanjaosta ei kuitenkaan ole näköpiirissä.
...

Täysin järjetön ajatus. Uudet (=löysemmät) turvapaikkakäytännöt ja taakanjako vain lisäisivät kuolemia, kun entistä useampi pyrkisi Eurooppaan turvapaikkaa hakemaan.

Tehokkaampi valvonta kansainvälisillä vesillä ja alusten hinaaminen takaisin Afrikkaan sekä varsinkin turvapaikkakäsittelyn ja turvapaikan saaneiden asuttamisen siirtäminen pois Euroopasta (Australian malliin) sen sijaan epäilemättä vähentäisivat Välimeren ylitystä yrittävien määriä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 05.07.2014, 15:46:52
Lainaus
...Italian puolivuotiskausi neuvoston johdossa suuntaa myös katseet Välimerelle ja siirtolais- ja turvapaikanhakijoihin. Vaikka edellinen puheenjohtajamaa Kreikka oli saman meren äärellä, eivät nämä kysymykset nousseet vielä keväällä vahvasti esiin. Nyt on odotettavissa toisenlainen linja. Viikoittaiset uutiset mereen hukkuneista tai laivoihin tukehtuneista ihmisistä ovat järkyttäviä, ja YK:n pakolaisjärjestö UNCHR arvioi 500 ihmisen menehtyneen Välimerellä tänä vuonna. Yksimielisyyttä uusista eurooppalaisista turvapaikkakäytännöistä ja etenkään niin sanotusta taakanjaosta ei kuitenkaan ole näköpiirissä.
...

Täysin järjetön ajatus. Uudet (=löysemmät) turvapaikkakäytännöt ja taakanjako vain lisäisivät kuolemia, kun entistä useampi pyrkisi Eurooppaan turvapaikkaa hakemaan.

Tehokkaampi valvonta kansainvälisillä vesillä ja alusten hinaaminen takaisin Afrikkaan sekä varsinkin turvapaikkakäsittelyn ja turvapaikan saaneiden asuttamisen siirtäminen pois Euroopasta (Australian malliin) sen sijaan epäilemättä vähentäisivat Välimeren ylitystä yrittävien määriä.

Juuri näin. EU tarvitsisi nyt puheenjohtajakseen Italian sijaan tolkun maan, joka rupeaisi ajamaan Australian mallia. Samoin oikeus- ja sisäasiainkomissaariksi pitäisi saada henkilö tolkun aatemaailmasta ja valtiosta Malmströmin tuhokauden jälkeen.

Pahoittelen, että tässä toistelen itseäni, mutta toivon tosiaan että Jussi ja muiden maiden kollegansa ovat hereillä siellä europarlamenissa NYT. Pahaa kyllä pelkään, että Katainen viime vuonna Italiassa käydessään myi Suomen tuen CEASille. Roopen toisaalla linkittämän tämänviikkoisen uutisen mukaan Stubb puhui taakanjaon puolesta Ruotsissa käydessään.

E: Roopen linkitys olikin tässä ketjussa, juuri tuossa ylempänä... :)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 09.07.2014, 15:57:46
Saksan sisäministeri Thomas de Maizieren mielestä Dublin-järjestelmä ei toimi ja suurin ongelma pakolaisten suhteen on heidän epätasainen jakautumisensa EU-maiden kesken, kun "osa maista ottaa vastaan aivan liian vähän pakolaisia suhteessa väkilukuunsa". Ministerin mukaan "yhteisen turvapaikkajärjestelmän toteuttaminen vaatii solidaarisuutta ja vastuullisuutta kaikilta osapuolilta" ja "Saksa on tähän valmis". Ministeri ei puhu suoraan turvapaikanhakijakiintiöistä, mutta toimittaja tulkitsee hänen tarkoittavan juuri niitä, kun toteaa, että suurin osa EU-maista vastustaa ajatusta maakohtaisista kiintiöistä.

"Taakanjakoa" perustellaan Lampedusalla ja Italian viimeaikaisilla paineilla, mutta itse asiassa artikkelin mukaan Italian taakka ei poistuisi kiintiöillä. Italia on EU-maista vasta sijalla 15, kun verrataan pakolaisten määrää väkilukuun.

Lainaus
While more and more people seek asylum in Europe, the EU's interior ministers are finding it hard to agree on how to divide responsibility for refugees between the EU member states. Italy has called for more solidarity.

[...]

The EU Commission has called on the EU member states to take in more refugees - including those in the UN Refugee Agency's shelters designated for resettlement. So far, 13 of the 28 EU states have taken part in such programs, European Commissioner for Home Affairs Cecilia Malmström said. De Maiziere indicated that Germany could do more in this area, but added that the main issue is the uneven distribution of responsibility within the EU.

"We also have states that, in relation to the size of their population, take in far too few refugees," said De Maiziere. This includes the central and eastern European states, he added. "A common implementation of the asylum system requires solidarity and responsibility from all parties. Germany is ready for it."

This year, the EU interior ministers are expecting an increase in refugee numbers due to the ongoing civil war in Syria and the unstable situation in Eritrea, Somalia and Sudan. Most EU states reject the idea of allocating refugees to different countries based on a strict quota. A system like this would not relieve Italy of its burden either: based on the current number of refugees in proportion to population size, Italy occupies the 15th spot in the EU. The top performers in this area are Sweden, Malta and Austria.
Deutsche Welle: Growing refugee numbers call for EU solidarity (http://www.dw.de/growing-refugee-numbers-call-for-eu-solidarity/a-17768449) 8.7.2014

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 09.07.2014, 16:18:31

"Taakanjakoa" perustellaan Lampedusalla ja Italian viimeaikaisilla paineilla, mutta itse asiassa artikkelin mukaan Italian taakka ei poistuisi kiintiöillä. Italia on EU-maista vasta sijalla 15, kun verrataan pakolaisten määrää väkilukuun.


Italialle nykyinen systeemi toimii todennäköisesti aika hyvin, koska Italia ei enää ota hakijoilta sormenjärkiä, joten Dublin-tapauksia ei heille palaudu juurikaan ja näin Italiasta onkin tullut vain sisäänheittomaa EU:hun, koska pakolaiset suuntaavat paremman sosiaaliturvan houkuttelemina pohjoisempaan eivätkä jää Italian rasitteeksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ihmisapina - 10.07.2014, 16:37:23
En kyllä ymmärrä maantieteellisiä seikkoja perusteluna sille miksi turvapaikanhakijoiden vastaanottamista pitäisi tasata EU-maiden välillä. Se on kylmä fakta että Italia ja Kreikka ovat ne maat joihin turvapaikanhakijoita tulee eniten, koska ne ovat Välimeren rannikolla. Saman tien Suomi voisi vaatia että kaikki mahdollinen Venäjän tuottama uhka, kaamosmasennus yms. sijainnista johtuvat asiat tasattaisi EU-maiden välillä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 12.07.2014, 04:50:49
Lainaus
Räsänen käyttää kuntien talousahdinkoa perusteena pakolaispolitiikalle

Sisäministeri Päivi Räsänen on ollut viimeisen vuoden aikana suuren valiokunnan kuultavana useita kertoja koskien EU:ssa hahmotteilla olevaa yhteistä turvapaikkapolitiikkaa. Olen kokouksissa toistuvasti kysynyt Räsäseltä, mitä EU:ssa tarkoitetaan esimerkiksi ns. solidaarisuudella, joka käsitteenä on usein esiintynyt valiokunnille annettavissa selvityksissä koskien turvapaikkapolitiikkaa.

Vastaukseksi on aina saatu, että jokainen jäsenmaa päättää toistaiseksi itse turvapaikkapolitiikastansa ja vastaanotettavien pakolaisten määrästä, eikä solidaarisuudella tarkoiteta esimerkiksi sitä, että me ottaisimme vastaan sellaisia turvapaikanhakijoita, jotka ovat ensin saapuneet johonkin toiseen EU-maahan, kuten Italiaan. Pikemminkin on annettu ymmärtää, että me tukisimme nykyistä enemmän EU:n ulkorajavalvontaa, jottei EU:n alueelle pääsisi niin paljon laittomia siirtolaisia.
...

Vesa-Matti Saarakkala

Saarakkala.fi (http://www.saarakkala.fi/blogi/2014/07/12/343)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Micke90 - 12.07.2014, 06:58:39
Itse käyttäisin kuntien (ja valtion) talousahdinkoa perusteena olla ottamatta pakolaisia. Silloin, kun on taloudellisesti tiukkaa, säästetään ensisijaisesti turhista menoista, joihin myös mamukulut lasketaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 12.07.2014, 08:03:36
Italialle nykyinen systeemi toimii todennäköisesti aika hyvin, koska Italia ei enää ota hakijoilta sormenjärkiä, joten Dublin-tapauksia ei heille palaudu juurikaan ja näin Italiasta onkin tullut vain sisäänheittomaa EU:hun, koska pakolaiset suuntaavat paremman sosiaaliturvan houkuttelemina pohjoisempaan eivätkä jää Italian rasitteeksi.

Lisäksi Italian taikaseinä on pahasti rikki.. Olen varma että Italian kustannukset sosiaaliturismista ovat pienemmät kuin Suomen vaikka tulijoita määrällisesti enemmän onkin. Epäsuoria kuluja toki on mm. rikollisuuden muodossa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: normi - 12.07.2014, 11:43:36
Nyt oli joku uutinen, että oliko se AMnesty, joka vaatii pakolaisten ja maahan tulijoiden oikeuksien turvaamista EU:lta.
Olen aina ihmetellyt tällaisille yksityisille epädemokraattisille pienen piirin järjesöille median antamaa vaikutusvaltaa. mediahan suhtautuu greenpeaceen, amnestyyn ja vastaaviin, kuin ne olisivat jotain VIRALLISIA tahoja jonkinlaisin legitiimein valtuuksin. Periaattessa sinä ja minä ja ensimmäinen vastaantulija voisimme perustaa minkä tahansa järjestön ja ryhtyä hyvän tarkoituksen varjolla esittämään erilaisia vaatimuksia kenelle tahansa... emme tarvitsisi äänestäjiä ja mittausta vaaleissa, kuten eivät nämäkään mainitut järjestöt tarvitse. Vähän sama, jos vaikkapa Microsoft tai "Matin lähikauppa" alkaisivat esittämään poliittisia vaatimuksia.
Ymmärrättekö mitä ajan takaa?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.07.2014, 16:16:21
Lainaus käyttäjältä: Jean-Claude Juncker 15.7.2014
8. Kohti uudenlaista maahanmuuttopolitiikkaa

Välimerellä viime aikoina tapahtuneet tragediat ovat osoittaneet, että EU:n on
kehitettävä muuttoliikkeen hallintaa kokonaisvaltaisesti
. Tämä on ennen kaikkea
humanitaarinen velvollisuus. Olen vakuuttunut siitä, että meidän on tehtävä läheistä
yhteistyötä solidaarisuuden hengessä
, jotta Lampedusan edustalla tapahtuneen
onnettomuuden kaltaisia tilanteita ei enää syntyisi.

Apua tarvitsevia on suojeltava eurooppalaisten arvojen pohjalta vahvan yhteisen
turvapaikkapolitiikan
avulla. Hiljattain sovittu yhteinen turvapaikkajärjestelmä on
pantava täytäntöön kaikilta osin, ja sen soveltamiseen liittyvät erot jäsenvaltioiden
välillä on poistettava
. Aion myös tutkia, voisiko Euroopan turvapaikka-asioiden
tukivirasto auttaa EU:n ulkopuolisia maita ja jäsenvaltioiden viranomaisia
pakolaistilanteen ja turvapaikkahakemusten käsittelemisessä hätätilanteissa tilanteen
salliessa jo lähtömaassa
.

Haluan edistää uudenlaista laillista maahanmuuttoa koskevaa EU:n politiikkaa.
Tämän politiikan avulla voitaisiin vastata erityisosaamisen tarpeeseen ja houkutella
Eurooppaan lahjakkaita ihmisiä helpottamaan unionin väestökehitykseen liittyvien
ongelmien ratkaisemista
. Haluan, että nämä muuttajat näkevät Euroopan vähintään
yhtä kiinnostavana kuin Australian, Kanadan tai Yhdysvallat. Aion ensi töikseni
tarkistaa sinistä korttia koskevaa lainsäädäntöä ja puuttua sen riittämättömään
täytäntöönpanoon.

Uskon myös, että laittomaan muuttoliikkeeseen on puututtava määrätietoisemmin
erityisesti kehittämällä yhteistyötä EU:n ulkopuolisten maiden kanssa esimerkiksi
takaisinoton osalta.

Nimeän erityisesti muuttoliikkeestä vastaavan komission jäsenen, joka hoitaa
tehtäväänsä yhteistyössä jäsenvaltioiden ja asianomaisten EU:n ulkopuolisten
maiden kanssa.

Lisäksi on turvattava Euroopan rajat. Yhteinen turvapaikka- ja
maahanmuuttopolitiikka toimii vain siinä tapauksessa, että onnistumme
pysäyttämään hallitsemattoman laittomien muuttajien virran.
Tästä syystä on
parannettava EU:n ulkorajayhteistyöstä huolehtivan viraston Frontexin toimintakykyä.

Vain 90 miljoonan euron vuosittainen budjetti ei alkuunkaan takaa Euroopan
yhteisten rajojen valvomisen edellyttämiä resursseja. On yhdistettävä jäsenvaltioiden
resursseja Frontexin työn tukemiseksi. Lisäksi eurooppalaisia rajavartijaryhmiä on
saatava nopeasti käyttöön Frontexin yhteisoperaatioissa ja rajainterventioissa. Tämä
on kaikkien jäsenvaltioiden, niin pohjoisten kuin eteläistenkin, yhteinen velvollisuus,
ja se on täytettävä yhteisvastuun hengessä.

Ihmiskauppaa koskevia yhteisiä eurooppalaisia sääntöjä on sovellettava ja niiden
täytäntöönpanoa on tehostettava, jotta ihmiskauppiaat voidaan saattaa vastuuseen
teoistaan. Hädänalaisia tai vainottuja ihmisiä hyväksikäyttävien rikollisten on aika
ymmärtää, että heitä seurataan Euroopan unionissa valppaasti ja että he joutuvat
vastaamaan teoistaan oikeudessa.
Jean-Claude Juncker: Uusi alku Euroopalle: Työllisyyden, kasvun, oikeudenmukaisuuden ja demokraattisen muutoksen ohjelma (http://ec.europa.eu/about/juncker-commission/docs/pg_fi.pdf) 15.7.2014

Euroopan komission puheenjohtaja Junckerin ohjelmasta:
- EU-maiden läheinen yhteistyö solidaarisuuden hengessä Lampedusan kaltaisten onnettomuuksien estämiseksi (miten?)
- Vahva EU:n yhteinen turvapaikka- ja maahanmuuttopolitiikka, jossa ei eroja jäsenmaiden kesken (mitä varten?)
- EASO:lle valtuudet käsitellä turvapaikkahakemuksia EU:n ulkopuolella (miksi ihmeessä?)
- Eurooppaan lisää "lahjakkaita ihmisiä" helpottamaan unionin väestökehityksen ongelmien ratkaisemisessa (ketä ja mihin?)
- Hallitsemattoman laittomien muuttajien virran pysäyttäminen ulkorajoilla yhteisen turvapaikka- ja maahanmuuttopolitiikan turvaamiseksi (miksi yhteinen politiikka, jos ongelma on ulkorajoilla?)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: slobovorsk - 02.08.2014, 10:55:29
Tähänkin ketjuun liittyen kuvateksti päivä paperi-Pravdasta: "Ruotsin komissaari on tulevallakin kaudella liberaalien Cecilia Malmström. Malmström on hoitanut menestyksekkäästi komission vaikeaa EU:n sisäasioiden salkkua."

Kauan ei enää voi elätellä toivoa siitä, että EU:n linja muuttusi tolkullisemmaksi maahanmuuttoasioissa uuden komission myötä. (Ei kyllä tainnut olla alun alkaenkaan realistista.)

Kohottakaamme kolminkertainen naamapalmu entisen Ruotsin porvarihallitukselle tästäkin hienosta päätöksestä!

 :facepalm: :facepalm: :facepalm:

Vaihtaisivat edes salkun siltä, ei kuitenkaan kalastusasioihin ...

 
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 02.08.2014, 11:07:46
Lainaus
Euroopan komission puheenjohtaja Junckerin ohjelmasta:

- EU-maiden läheinen yhteistyö solidaarisuuden hengessä Lampedusan kaltaisten onnettomuuksien estämiseksi (miten?)
- Vahva EU:n yhteinen turvapaikka- ja maahanmuuttopolitiikka, jossa ei eroja jäsenmaiden kesken (mitä varten?)
- EASO:lle valtuudet käsitellä turvapaikkahakemuksia EU:n ulkopuolella (miksi ihmeessä?)
- Eurooppaan lisää "lahjakkaita ihmisiä" helpottamaan unionin väestökehityksen ongelmien ratkaisemisessa (ketä ja mihin?)
- Hallitsemattoman laittomien muuttajien virran pysäyttäminen ulkorajoilla yhteisen turvapaikka- ja maahanmuuttopolitiikan turvaamiseksi (miksi yhteinen politiikka, jos ongelma on ulkorajoilla?)

Tämän kaiken tarkoituksena on Euroopan ja sen kansojen tietoinen tuhoaminen. Palaset alkavat loksahdella paikoilleen kun myöntää itselleen, että päättäjillämme ei edes ole tarkoituksena lisätä hyvinvointiamme, vaan yksinkertaisesti murskata meidät ja vapautemme. Aseena tässä käytetään monia keinoja, yhtenä karmaisevana esimerkkinä Euroopan pakkomonikultturistaminen, joka tuhoaa kansallisvaltiot, sosiaaliset rakenteet, talouden, kulttuurin, vapauden, sananvapauden, ihmisoikeudet ja arjen turvallisuuden. Hajoitettuja on helppo hallita. Tämä on tarkoitus ja tavoite, joskin se tietenkin naamioidaan ihmisoikeusdiskurssiin ja muuhun söpöön. Kyseessä on historiallinen petos ja sota ihmisyyttä vastaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.08.2014, 11:32:29
Tähänkin ketjuun liittyen kuvateksti päivä paperi-Pravdasta: "Ruotsin komissaari on tulevallakin kaudella liberaalien Cecilia Malmström. Malmström on hoitanut menestyksekkäästi komission vaikeaa EU:n sisäasioiden salkkua."

Kiinnitin huomiota samaan. Toimittaja Annamari Sipilä (HS:n pääkirjoitustoimittaja) ei mitenkään täsmentänyt luonnehdintaansa itse tekstissä.

Miten ihmeessä sellainen maahanmuuttokomissaari voi olla menestyksekäs, joka omienkin sanojensa mukaan on epäonnistunut tavoitteeksi asettamansa EU:n yhteisen maahanmuuttopolitiikan saavuttamisessa? Etenkin kun hän on ajanut tavoitteitaan (EU:n ulkopuoliset turvapaikanhakukeskukset, vapaa pääsy EU-maihin arabikevätmaista jne.) vastoin kaikkien jäsenmaiden tahtoa (Malmströmin oma kuvaus tapahtuneesta).

edit:
Malmströmin asenteesta:
Alkuperäisessä WSJ:n jutussa (http://blogs.wsj.com/brussels/2014/06/26/the-eu-at-a-migration-crossroads-speaking-with-cecilia-malmstrom/) Malmström myöntää avoimesti, että yksikään jäsenmaa ei ole kannattanut hänen vaatimustaan EU:n ulkopuolelle sijoitettavista turvapaikanhakutoimistoista, joissa siis jo yksi Libyan Benghasiin perustettava keräisi Malmströmin itsensäkin mukaan 200 000 ihmisen jonon yhdessä päivässä. Malmströmin kommentti jäsenmaiden vastentahtoisuuteen kertoo kaiken:

Lainaus käyttäjältä: Maahanmuuttokomissaari Cecilia Malmström, WSJ
Nobody is interested in this. Not one single member state. But nevertheless we will do it.

EU tosiaan "lisäisi maahanmuuttoa haluavien mahdollisuuksia" ja vie eteenpäin EU:n yhteistä turvapaikkajärjestelmää, vaikka sitten vastoin EU-maiden tahtoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ike60 - 02.08.2014, 22:00:56
Lainaus käyttäjältä: Jean-Claude Juncker 15.7.2014
8. Kohti uudenlaista maahanmuuttopolitiikkaa

[blablabla]

Apua tarvitsevia on suojeltava eurooppalaisten arvojen pohjalta vahvan yhteisen
turvapaikkapolitiikan
avulla. Hiljattain sovittu yhteinen turvapaikkajärjestelmä on
pantava täytäntöön kaikilta osin, ja sen soveltamiseen liittyvät erot jäsenvaltioiden
välillä on poistettava
. [pölöpölö]
Jean-Claude Juncker: Uusi alku Euroopalle: Työllisyyden, kasvun, oikeudenmukaisuuden ja demokraattisen muutoksen ohjelma (http://ec.europa.eu/about/juncker-commission/docs/pg_fi.pdf) 15.7.2014

Mikä hiljattain sovittu yhteinen turvapaikkajärjestelmä? Onko Malmström sittenkin saanut uitettua läpi sen kauhuskenaarioehdotuksen, jossa Suomen turvapaikanhakijat moninkertaistuisivat? Vai onko kyseessä jokin toinen sopimus? Ketkä tästä asiasta ovat sopineet? Mikä on sopimuksen sisältö?

Anteeksi että häiritsen, mutta tämä saattaa olla merkittävin Suomen maahanmuuttotilanteeseen vaikuttava päätös sen jälkeen, mun ulkomaalaisvaltuutettu Seppälä kävi ulkomailta noutamassa meille somaleita turvapaikanhakijoiksi Neuvostoliitosta. Pahimmassa tapauksessa tänne aletaan rahtaamaan massoittain turvapaikanhakijoita, jotka eivät tänne olisi muuten tulleet (tai edes mistään Suomesta kuulleet).
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.08.2014, 17:52:18
Sveitsin demarioikeusministeri Simonetta Sommarugan mielestä Dublin-sopimusta, jonka mukaan hakemus käsitellään siinä Euroopan maassa, johon turvapaikanhakija saapuu ensiksi, on "tarkasteltava uudelleen". Ministerin mukaan nykyinen järjestelmä rasittaa kohtuuttomasti esimerkiksi Italiaa, johon saapuu päivittäin 1000-2000 turvapaikanhakijaa. Sommaruga ehdottaakin, että turvapaikanhakijat jaettaisiin tasaisemmin Euroopan valtioiden kesken kaavalla, joka perustuu maiden väkilukuun ja vaurauteen.

Ministerin lausunto on vastaveto Sveitsin suurimman puolueen SVP:n äskettäiseen vaatimukseen, että Dublin-sopimusta ryhdyttäisiin soveltamaan tiukemmin. EU-maiden ympäröimässä Sveitsissä tämä tarkoittaisi sitä, että ainoastaan lentokoneella maahan saapuvien turvapaikkahakemukset otettaisiin käsittelyyn, kun taas maitse saapuvien tulkittaisiin saapuneen turvallisesta maasta. Puolue ajaa asiasta kansanäänestystä. Oikeusministeri Sommaruga torjui vaatimuksen, koska hänen mukaansa tällainen rajoitus lopettaisi turvapaikanhakijoiden tulon Sveitsiin.

Global Post: Switzerland urges revision of European asylum rules (http://www.globalpost.com/dispatch/news/afp/140807/switzerland-urges-revision-european-asylum-rules) 7.8.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Micke90 - 10.08.2014, 18:36:59
Sveitsin demarioikeusministeri Simonetta Sommarugan mielestä Dublin-sopimusta, jonka mukaan hakemus käsitellään siinä Euroopan maassa, johon turvapaikanhakija saapuu ensiksi, on "tarkasteltava uudelleen". Ministerin mukaan nykyinen järjestelmä rasittaa kohtuuttomasti esimerkiksi Italiaa, johon saapuu päivittäin 1000-2000 turvapaikanhakijaa. Sommaruga ehdottaakin, että turvapaikanhakijat jaettaisiin tasaisemmin Euroopan valtioiden kesken kaavalla, joka perustuu maiden väkilukuun ja vaurauteen.

Miksi sveitsiläinen ministeri välittää noin kovasti Italian kohtalosta? Olisiko parempi, jos kaikki Italiaan saapuvat elintasopaikanhakijat tulisivatkin Sveitsiin?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Onnikka - 10.08.2014, 18:59:03
Sveitsin demarioikeusministeri Simonetta Sommarugan mielestä Dublin-sopimusta, jonka mukaan hakemus käsitellään siinä Euroopan maassa, johon turvapaikanhakija saapuu ensiksi, on "tarkasteltava uudelleen". Ministerin mukaan nykyinen järjestelmä rasittaa kohtuuttomasti esimerkiksi Italiaa, johon saapuu päivittäin 1000-2000 turvapaikanhakijaa. Sommaruga ehdottaakin, että turvapaikanhakijat jaettaisiin tasaisemmin Euroopan valtioiden kesken kaavalla, joka perustuu maiden väkilukuun ja vaurauteen.

Miksi sveitsiläinen ministeri välittää noin kovasti Italian kohtalosta? Olisiko parempi, jos kaikki Italiaan saapuvat elintasopaikanhakijat tulisivatkin Sveitsiin?
Arvaus:
Josko on etnisyydeltään italialainen?
Ja esittää jakoa varmaankin EU-maihin?
Mikä hiljattain sovittu yhteinen turvapaikkajärjestelmä?
Arvaus:
Olisiko niin että Suomi(kin) on jo salassa jotain ratifioinut.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ike60 - 10.08.2014, 23:27:28
Mikä hiljattain sovittu yhteinen turvapaikkajärjestelmä?
Arvaus:
Olisiko niin että Suomi(kin) on jo salassa jotain ratifioinut.

Ilmeisesti systeemi on vasta tulossa, mutta siitä on jo jaettu (http://ec.europa.eu/dgs/home-affairs/what-we-do/policies/asylum/index_en.htm) hallintoalamaisille tietoa (http://ec.europa.eu/dgs/home-affairs/e-library/docs/ceas-fact-sheets/ceas_factsheet_en.pdf). Tosin tieto haiskahtaa valikoidulta. Olisi todella hyvä jos joku voisi perehtyä CEASin todelliseen sisältöön - siis niihin määräyksiin joita EU-maille CEASissa annetaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.09.2014, 13:38:40
YK:n pakolaiskomissaari António Guterres ylistää Saksan pakolaispolitiikkaa, kun se on ilmoittanut ottavansa vastaan 20 000 syyrialaista kiintiöpakolaista. Samaan aikaan turvapaikanhakijoiden vastaanotto on ajautunut Saksassa yhä pahempaan kriisiin. Kunnilla ei ole tarjota tulijoille kunnollisia asuntoja, joten turvapaikanhakijoita on sijoitettu telttoihin ja varastoihin.

Myös ihmisoikeusjärjestö Pro Asylin analyytikko kehuu Saksaa, mutta vaatii sekä Saksalta että etenkin muilta Euroopan mailta lisäpanostusta pakolaisongelman ratkaisemiseksi. Ihan ensimmäiseksi pakolaiset pitäisi jakaa reilusti EU-jäsenmaiden kesken. Saksa ei ole edistänyt kyseistä taakanjakohanketta vaan päinvastoin jarruttanut sen etenemistä. Koppin mielestä ei muutenkaan ole hyväksyttävää, että yksi maailman rikkaimmista maista majoittaa ihmisiä varastorakennuksiin.

Saksan kuntaliiton johtaja Gerd Landsbergin mukaan yhä suurempia ongelmia pakolaisten takia kohtaavat kunnat tarvitsevat nyt "jonkinlaista Marshall-apua". Lansberg ehdottaa kansallista rakennusohjelmaa, jonka kautta pakolaisille rakennettaisiin uusia tiloja ja muunnettaisiin olemassaolevia tiloja pakolaisten käyttöön. Lisäksi keskipitkällä aikavälillä EU voisi siirtyä pakolaisten jakamiseen ympäri Eurooppaa. Landsberg ehdottaa EU:lle erityistä pakolaiskomissaaria. Landsberg ennakoi, että pakolaisten määrä tulee jatkossa todennäköisesti kasvamaan yhä dramaattisemmin.

EurActiv: UN High Commissioner praises Germany’s refugee policy (http://www.euractiv.com/sections/development-policy/un-high-commissioner-praises-germanys-refugee-policy-308193) 4.9.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.09.2014, 18:04:04
Uudeksi maahanmuuttokomissaariksi valittiin Kreikan puolustusministeri Dimitris Avramopoulos. Cecilia Malmström jatkaa tuhotöitään seuraavat vuodet EU:n kauppakomissaarina.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Golimar - 10.09.2014, 18:07:26
Hullun Cecilian mielestä Eurooppaa suosivat muurit on revittävä alas.

http://avpixlat.info/2014/09/10/cecilia-malmstrom-fp-riva-murar-gynnar-europa/
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: OTU - 10.09.2014, 18:11:01
Tämä Cecilia Malmström on pahempi Molotov, Göbbels ja Pol pot jne. Ei lataa RK:ta, mutta tekee paperilla äklöttäviä asioita.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Publicola - 11.09.2014, 14:55:14
Uudeksi maahanmuuttokomissaariksi valittiin Kreikan puolustusministeri Dimitris Avramopoulos. Cecilia Malmström jatkaa tuhotöitään seuraavat vuodet EU:n kauppakomissaarina.

Junckerin mission letterin Avramopoulokselle pääsee lukemaan tästä (http://ec.europa.eu/about/juncker-commission/docs/avramopoulos_en.pdf). Maahanmuuton tulevia tuulia voi haistella sivulla 4. Olennaisin ainakin tämän threadin kannalta on ehkä tässä:

Lainaus
During our mandate, I would like you to focus on the following: (...)
  • Working to ensure the full and consistent implementation of the Common European Asylum System. We should look at an extended role for the European Asylum Support Office, with a particular focus on working with and in third countries. We should also develop a strategy for improving our response to emergency situations. 
  • Working with the High Representative of the Union for Foreign Affairs and Security Policy/Vice-President and the Commissioner for International Cooperation and Development on ways to improve cooperation with third countries on these aspects, including on readmission.

Eli ellen ymmärrä väärin,  pakolaispolitiikkaa ja -käytäntöjä aiotaan yhtenäistää ja niiden täytäntöönpanoa tehostaa, mutta yhteistyötä kolmansien maiden (ts lähtömaiden) kanssa aiotaan kehittää, ml. käännytysten suhteen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 11.09.2014, 15:29:42
Eli ellen ymmärrä väärin,  pakolaispolitiikkaa ja -käytäntöjä aiotaan yhtenäistää ja niiden täytäntöönpanoa tehostaa,

Ei pelkästään yhtenäistää politiikkaa ja käytäntöjä (vrt. harmonisointi direktiiveillä) vaan Junckerin tavoitteena on yksi yhteinen turvapaikkapolitiikka, joka toteutetaan CEASin kautta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Publicola - 11.09.2014, 15:44:24
Eli ellen ymmärrä väärin,  pakolaispolitiikkaa ja -käytäntöjä aiotaan yhtenäistää ja niiden täytäntöönpanoa tehostaa,

Ei pelkästään yhtenäistää politiikkaa ja käytäntöjä (vrt. harmonisointi direktiiveillä) vaan Junckerin tavoitteena on yksi yhteinen turvapaikkapolitiikka, joka toteutetaan CEASin kautta.

Aivan, tarkoitinkin sitä, mutta ilmaisin asian virheellisyyteen asti menevällä epätarkkuudella. Eli Junckerin meininkinä on tosiaan implementoida EU:lle yhteistä pakolaispolitiikkaa.

Vielä lisätietona yhteistyöstä kolmansien maiden kanssa: Avramopoulos ei siis ole yksin kehittämässä tällaista yhteistyötä, vaan mukana ovat kansainvälisestä yhteistyöstä ja kehityksestä vastaava komissaari Neven Mimica ja ulkoasiain ja turvallisuuspolitiikan korkea edustaja Federica Mogherini. Molemmat ovat sosialidemokraatteja. Mimica on opiskellut taloustiedettä, pikaisella googletuksella en löytänyt puoluetaustaa tarkempia viitteitä maahanmuuttopoliittisista näkemyksistä. EurActivin mukaan (http://www.euractiv.com/sections/global-europe/profile-federica-mogherini-next-eu-foreign-affairs-chief-308102) vain 41-vuotias Mogherini taas on "tyypillinen keskustavasemmistolainen poliitikko", jonka tausta on rasismin, ksenofobian ja apartheidin vastaisessa vasemmistoaktivismissa. Eli kuulostaa mahdollisesti potentiaaliselta malmströmistiltä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.09.2014, 14:35:17
Saksan sisäministeri Thomas de Mazière aikoo julkistaa lokakuun alussa ehdotuksensa EU:n jäsenmaakohtaisista pakolaiskiintiöistä. de Mazière puhuu vielä Der Spiegelin haastattelussa "vapaaehtoisuudesta" ja "solidaarisuudesta", mutta kuten europarlamentissa todettiin jo vuosia sitten, kiintiöt eivät ole toimineet vapaaehtoisuuden pohjalta, joten tarvitaan "pakollista solidaarisuutta". Epäilemättä de Mazière on tästä hyvin tietoinen.

Lainaus
At the beginning of October, de Maizière wants to propose the establishment of refugee quotas for each EU member state. "If everyone adheres to the rules, then other countries could voluntarily help reduce the burden for a limited amount of time on countries like Italy, where a disproportionate number of refugees arrive," he said. Put more simply, this means that Italy would have to take in more than the 30,000 people that it processed last year, but nowhere near the number of people who are actually landing on its shores. The other EU member states would step in to help. It would also mean that the number of people applying for asylum in Germany would go down.

The precondition, de Maizière wrote in a letter to EU Home Affairs Commissioner Cecilia Malmström at the beginning of September, would be for countries like Italy to "swiftly register the people who may have the right to international protection and those who would not be eligible and for them to be quickly sent back to their country of origin or the country from which that person first traveled to Europe." Joachim Hermann, the interior minister for the state of Bavaria, supports this view, noting, "We need to have a fairer sharing of burdens in Europe if individual countries are overstrained."

This would spell, at least temporarily, the end of the Dublin Regulation. But would it solve the problem?

If the quotas are to be taken seriously, the refugees would have to be distributed across Europe -- at times even against their will. And "deportation," a bad word in Europe, would quickly be at the tip of people's tongues. One of the main hitches, though, is that many EU countries would have to show a readiness to finally accept an appreciable number of refugees. That hasn't been the case so far with 10 of the 28 member states. "It's not right that four or five countries take in the largest number of refugees," de Maizière said. "That doesn't reflect the kind of Europe-wide solidarity that we so urgently need."
Der Spiegel: Sharing Burdens: Germany to Urge Shift in EU Refugee Policy (http://www.spiegel.de/international/germany/germany-to-urge-shift-in-eu-refugee-policy-a-993076.html) 22.9.2014

Jos tämä tosiaan merkitsee Saksan suunnanmuutosta suhteessa "taakanjakoon" ja johtaa EU-maiden pakollisiin tai "vapaaehtoisiin" pakolaiskiintiöihin, on se loikka kylmään tuntemattomaan. Siinä missä Suomelle kaavailtu (http://www.statewatch.org/news/2010/nov/eu-com-final-report-relocation-of-refugees.pdf) "solidaarinen" osuus EU:n turvapaikanhakijoista oli jo vuoden 2008 hakijamäärillä 10 000 - 20 000 (http://hommaforum.org/index.php/topic,27433.msg580156.html#msg580156), olisi se tämän vuoden hakijamäärillä yli kaksinkertainen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 24.09.2014, 14:43:27
Lainaus
Quote Roope:
Jos tämä tosiaan merkitsee Saksan suunnanmuutosta suhteessa "taakanjakoon" ja johtaa EU-maiden pakollisiin tai "vapaaehtoisiin" pakolaiskiintiöihin, on se loikka kylmään tuntemattomaan. Siinä missä Suomelle kaavailtu "solidaarinen" osuus EU:n turvapaikanhakijoista oli jo vuoden 2008 hakijamäärillä 10 000 - 20 000, olisi se tämän vuoden hakijamäärillä yli kaksinkertainen.

Kuinka tällaisen ylivelkaantuneen, erään maailman kalleimmista maista asua, infra kestäisi tuollaista invaasiota on eri juttu. Enää tuossa vaiheessa ei höpistä käsittelystä eikä kotouttamisesta vaan asuttamisesta kontteihin.

Ero EU:sta ja äkkiä. Antaa heidän itse kantaa taakkansa rikkauksia ja voimavaroja kun kerran ovat ottaneetkin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.09.2014, 14:55:21
Kuinka tällaisen ylivelkaantuneen, erään maailman kalleimmista maista asua, infra kestäisi tuollaista invaasiota on eri juttu. Enää tuossa vaiheessa ei höpistä käsittelystä eikä kotouttamisesta vaan asuttamisesta kontteihin.

En usko, että kiintiöitä esitetään otettavaksi heti alkuvaiheessa käyttöön koko laajuudessaan. Vastustus olisi valtavaa.

Vaikea nähdä ratkaisua siihenkään, että päätöskriteerit vaihtelevat suuresti maasta toiseen. Kuten Euroopan turvapaikkatoimiston eilen julkaistussa vuosiraportissa (http://hommaforum.org/index.php/topic,95933.msg1704422.html#msg1704422) todettiin, Suomessa kaikki somalit saivat oleskeluluvan, mutta Ruotsissa vain joka kymmenes. (edit: Tuo raportin kohta koski turvapaikkapäätöksistä tehtyjä valituksia.)

Kiintiöitä on mahdoton toteuttaa perustellusti ilman yhteisiä turvapaikkakriteerejä, mutta niihin päin ei olla kaikesta puheesta huolimatta menossa. Joten saa nähdä, mitä tuolta on oikeasti tulossa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Onnikka - 24.09.2014, 15:21:10
"We need to have a fairer sharing of burdens in Europe if individual countries are overstrained."
Äkkiä tästä kehittää sellaisenkin ajatuksen että maat joissa on eniten, pitää vaikka taukoa sulatellakseen rikkaudet ja niihin maihin joissa ennestään on vähiten jne.
Kuinka tällaisen ylivelkaantuneen, erään maailman kalleimmista maista asua, infra kestäisi tuollaista invaasiota on eri juttu. Enää tuossa vaiheessa ei höpistä käsittelystä eikä kotouttamisesta vaan asuttamisesta kontteihin.

Ero EU:sta ja äkkiä. Antaa heidän itse kantaa taakkansa rikkauksia ja voimavaroja kun kerran ovat ottaneetkin.
Infran suhteen ei mitään ongelmaa. Eikä vastustustakaan tulisi, maa on niin keskusjohtoinen että kun päälliköt jotain käskee, pikkupomot tottelee. Kansa taasen ei ole tähänkään mennessä protestoinut.
Infran kannalta 40000 uutta asukasta on hyvin pieni määrä. Kymmenessä vuodessa tuleva 400000 samoin. Tilaa on. Ruuhkia ei ole. Kuntien vesijohto, sähkö ym. verkot kestää hyvin lisäyksen.

Rakennuskapasiteettia on, rakennusmiehiä työttöminä ja betonitehtaat voi laittaa kolmeen vuoroon jos enempi kuutioita tarvitaan. Tuollainen 40000 uutta asukasta, jos jokaiselle rakennetaan 40 neliön verran asuntoa, tarkoittaa vain kymmenen prosentin verran lisärakentamista verrattuna nykytilanteeseen. (Jos oikein päässä laskin.) Eli mahtavat rikkaudet ja taloushyödyt, bkt:n kohoamiset sun muuta tiedossa.

Kansa sitten hiukka toinen juttu ja talous. Vaikka EU "maksaisi" viulut - nämä "" sillä että kansahan ne huvit maksaa kuitenkin - niin lisää työttömiähän sitä tulisi. Vaikka heitä koulutettaisiinkin, niin sitten vastaavasti laitettaisiin pihalle suomalaisia. Kuten nykyisin vaikka olisi Helsingissä syntynyt, ei tipu asuntoa kunnalta koska kunniakansalaiset menee ohi jonojen. Niin saattaisi hyvin käydä näittenkin osalta joita tulee. Helsinkiin 4000 suomalaista asunnotonta lisää, samassa suhteessa muuallekin moneen paikkaan missä tyhjiä vuokra-asuntoja ei ole tai takuuvuokrat ovat yli köyhien maksukyvyn. Mamukeskuksia kyllä kohoaisi toinen toistaan upeampia, olisi se hienoa kun yritysten pääkonttoreita reippaasti hienompia rakennuksia olisi entistä enemmän.

Koska puolueet ei demokratiaa kannata, ei kansalta kysytä asiasta mitään. Näin ollen, kunhan ensin Suomen talous on ajettu alas ja kapasiteettia vaikkapa rakentamiseen on puolet tarjolla, ajanevat jotain palkkiota yhteisistä EU:n rahoista joilla sitten väkeä alkaa lappaan sisään. Esim. 10000 euroa pakolaista kohti niin johan alkaa innostumaan kunnat että tällä rikastutaan.
Kiintiöitä on mahdoton toteuttaa perustellusti ilman yhteisiä turvapaikkakriteerejä, mutta niihin päin ei olla kaikesta puheesta huolimatta menossa. Joten saa nähdä, mitä tuolta on oikeasti tulossa.
Katsovat mitkä maat eniten tottelee ja niihin eniten?  ;D
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 24.09.2014, 15:34:53
Katsovat mitkä maat eniten tottelee ja niihin eniten?  ;D

Kyllä. Tärkeintähän ei ole aluksi järjestelmän toiminta vaan sen rakenteiden pystyttäminen ja vakiinnuttaminen. Kannustimeksi riittää Suomen ja joidenkin Itä-Euroopan köyhien maiden kohdalla nimellinen korvaus. Sisäministeri Räsänen kuittasi kiintiöpakolaisten vastaanoton hoituvan muutaman tonnin EU-tuella ja vaati heitä vielä lisääkin. Sama innostunut meininki monissa kiintiöpakolaisia vastaanottavissa kunnissa, jotka saavat valtiolta korvauksia neljän vuoden ajan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Uimakoulutettava - 24.09.2014, 23:03:50
No, hö.

Eivätkö Ruotsin rajat olekaan kaikille auki? Rasismia! :'( :flowerhat: Aivan kauhiaa rasismia on myös se, että turvapaikkahakemusten perusteita tutkittaisiin.

Rinkeby on solidaarisuuden mekka, Euroopan rasismivapain vyöhyke.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.09.2014, 18:47:12
Lainaus
During yesterday’s meeting of the European Parliament’s Committee on Civil Liberties, Justice and Home Affairs, the European Asylum Support Office (EASO) presented the EASO Annual Activity Report for 2013, the Annual Report on the situation of asylum in the EU 2013, and the EASO multi-annual work programme 2014 - 2016 "Towards a coherent implementation of the Common European Asylum System". EASO also presented the latest asylum trends for 2014.

[...]

In the coming years, EASO shall particularly focus its efforts on supporting Member States’ implementation of the asylum acquis following the adoption of the legal instruments of the Common European Asylum System and providing Operational Support to Member States. Moreover, EASO will have a more central role in coordinating capacity building measures through training, practical cooperation activities, Country of Origin Information and quality reports.

The presentation was followed by an EASO information event at the European Parliament. The event aimed at informing the EU staff working at the European Parliament of EASO’s main support tools and activities.
New Europe: 28% rise in the number of applications for asylum in the EU (http://www.neurope.eu/article/28-rise-number-applications-asylum-eu) 25.9.2014

EASO multi-annual work programme 2014 - 2016 "Towards a coherent implementation of the Common European Asylum System" (http://EASO multi-annual work programme 2014 - 2016 "Towards a coherent implementation of the Common European Asylum System") (pdf)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.10.2014, 00:58:37
Tulevan maahanmuuttokomissaarin eilisestä tentistä:

Lainaus
EU embassies should take asylum requests, new commissioner says

Dimitris Avramopoulos , the incoming Greek EU commissioner for migration and home affairs, wants offices set up at the EU's foreign embassies to allow people to apply for asylum.

“We should have offices in the EU delegations all over the world, in particular in third countries, where we should allow people to apply for asylum or for legal migration status,” Avramopoulou told euro-deputies at his hearing on Tuesday (30 September).

[...]

Up for possible review is the EU’s Dublin regulation, a policy that requires point-of-entry member states to take charge of all incoming asylum requests. The policy has generated controversy for the lack of solidarity among member states to help process claims.

[...]

He noted tackling irregular migration requires respecting fundamental rights but warned against setting up a Fortress Europe, in reference to border control policies that prevent people from entering the EU in the first place.

That entails tackling populism and xenophobia in Europe head on.

“Let me clear from the very beginning, the answer to these challenges is definitely not Fortress Europe,” he said.
EUobserver (http://euobserver.com/justice/125826) 30.9.2014

Lainaus
Proposed EU Migration Commissioner Avramopoulos Talks the Talk

Creating legal, safe routes to the European Union will be his top priority for the next five years, Dimitris Avramopoulos, the commissioner-designate for migration and home affairs, told European parliamentarians Tuesday.

“Legal migration is a fence against illegal migration,” said Mr. Avramopoulos, echoing the view of many of human-rights organizations. The chairpersons of the Parliament’s Committee on Civil Liberties, Justice and Home Affairs were expected to decide on his appointment later Tuesday, ahead of a plenary vote on the full European Commission planned for Oct. 22.

[...]

He said migrants should be allowed to apply for asylum or work visa abroad, at EU embassies in non-EU countries. This proposal was floated by the outgoing commission earlier this year, but nixed at member-state level. “Where we have embassies we need to have a migration consultant,” he said.

Mr. Avramopoulos repeatedly decried policies he said turned the EU into “Fortress Europe,” a label attached to the bloc by asylum advocates for fortifying its borders and keeping migrants out, often at the cost of their lives. He also condemned his own government’s work in building a 10-km long fence along Greece’s land border with Turkey in the region of Evros.

[...]

In keeping with his own country’s agenda, Mr. Avramopoulos called for more “solidarity” within the EU in dealing with migrants. That word is code for having irregular migrants and refugees processed and accepted across the bloc and directing more EU funding to border countries like Greece and Italy.
The Wall Street Journal (http://blogs.wsj.com/brussels/2014/09/30/proposed-eu-migration-commissioner-avramopoulos-talks-the-talk/) 30.9.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jari Leino - 02.10.2014, 01:03:28
Hienoa. Lopullinen romahdus nopeutuu.

Suomella voi olla vielä mahdollisuus tulla järkiinsä ja pelastua, jos EU tuhoutuu mahdollisimman pian ja mahdollisimman väkivaltaisesti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: niemi2 - 02.10.2014, 07:36:03
Epämääräiseksi jää vähentäisikö tämä uuden komissaarin tapa oleskelulupia toissijaisen suojelun perusteella ja ei-pakolaiseksi todetut tapaukset jäävät pois. Todennäköisimmin entinen meno jatkuu, mutta sen lisäksi parhaat itkutarinat palkitaan lähetystöissä UNHCR:n sijaan.

EU haluaa kuitenkin tuosta tehdä maahanmuuttoväylän.

UNHCR:llä on jo mekanismi, jolla se toteaa voidaanko suojelu toteuttaa vaikka pakolaisleirillä vai tarvitaanko uudelleensijoitusta. Kaikki tarvittavat keinot on siis jo olemassa, mutta EU haluaa lisää ihmiskauppaa, salakuljetusta ja inhimillistä kärsimystä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Publicola - 02.10.2014, 09:50:42
Tulevan maahanmuuttokomissaarin eilisestä tentistä:

EUobserver (http://euobserver.com/justice/125826) 30.9.2014

The Wall Street Journal (http://blogs.wsj.com/brussels/2014/09/30/proposed-eu-migration-commissioner-avramopoulos-talks-the-talk/) 30.9.2014

Kuulostaa tuon perusteella jokseenkin pahimmalta mahdolliselta. Olen pettynyt Avramopoulokseen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.10.2014, 10:03:42
Kuulostaa tuon perusteella jokseenkin pahimmalta mahdolliselta. Olen pettynyt Avramopoulokseen.

Toisaalta tuo oli juuri sellaista settiä, jota valiokunnan enemmistö halusi kuulla. Yhtään realistisilla linjauksilla LIBE olisi raakannut Avramopouloksen, joka on ennen kaikkea poliittinen eläin. Tenttien jälkeen hänestä voi hyvinkin kuoriutua sujuvasanainen selittelijä, joka ei saa aikaan yhtään mitään.

Avramopouloksesta ei ole minusta syytä huolestua, ennemminkin Saksan mahdollisista paniikkireaktioista sikäläiseen turvapaikanhakijatulvaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 02.10.2014, 16:13:20
Commissioner Cecilia Malmström commemorates the Lampedusa tragedy
European Commission - STATEMENT/14/296   02/10/2014 (http://europa.eu/rapid/press-release_STATEMENT-14-296_en.htm)

Today it is virtually impossible to come to Europe in a legal and safe way. Migrants are forced to put their lives in the hands of traffickers and smugglers who are making huge profits by exploiting their misery and despair.
---

Let me be very clear – when it comes to accepting refugees, solidarity between EU member states is still largely non-existent. This is quite possibly our biggest challenge for the future. While some EU members are taking responsibility, providing refuge for thousands of refugees, several EU countries are accepting almost no-one. In some countries, the number of yearly refugees barely exceeds a few handfuls. Last year, six whole countries of the EU accepted less than 250 refugees between them. All this, while the world around us is in flames. These EU countries could quite easily face up to reality by accepting resettled refugees through the UN system, but despite our persistent demands they are largely refusing. This is nothing short of a disgrace.

If all the promises after the Lampedusa tragedy are to mean anything, solidarity between EU countries must become reality. For this to happen, we must in the coming years develop a responsibility-sharing mechanism between all EU states. This is of course nothing that can be forced upon Member States. However, I believe it is an absolute necessity if the EU is to live up to its ideals.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Trendkill - 02.10.2014, 16:44:33
Lainaus käyttäjältä: Cecilia Malmström
All this, while the world around us is in flames.

Kiinnostavaa, että keskustelun retoriikka on komissaarien tasolla tällaista.

Lainaus käyttäjältä: Cecilia Malmström
Last year, six whole countries of the EU accepted less than 250 refugees between them.

Mitkäköhän maat ovat kyseessä? Mielikuvien perusteella voisin arvailla, mutta kiinnostaisi vain tietää.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.10.2014, 17:32:18
Lainaus käyttäjältä: Cecilia Malmström
Last year, six whole countries of the EU accepted less than 250 refugees between them.

Mitkäköhän maat ovat kyseessä? Mielikuvien perusteella voisin arvailla, mutta kiinnostaisi vain tietää.

Lainaus
Viro 10
Kroatia 25
Latvia 35
Slovenia 40
Liettua 60
Slovakia 75
...
Suomi 1 795
...
Ruotsi 26 395
Eurostat: EU Member States granted protection to 135 700 asylum seekers in 2013 (http://epp.eurostat.ec.europa.eu/cache/ITY_PUBLIC/3-19062014-BP/EN/3-19062014-BP-EN.PDF)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 03.10.2014, 14:15:45
En tiedä onko tätä ollut täällä aikaisemmin, mutta tämä on tuorein EPP:n kannanotto, mitä löysin.

Toki parlamentaarikot ovat vaihtuneet tässä välissä, mutta EPP siis täysin kannattaa ihmisten uudelleensijoittelua, joka perustuu kunkin jäsenvaltion laskennalliseen resurssiavaimeen, joka johtaa reiluun taakanjakoon.

http://www.eppgroup.eu/press-release/Asylum-Package%3A-Yes-to-help%2C-No-to-abuse (http://www.eppgroup.eu/press-release/Asylum-Package%3A-Yes-to-help%2C-No-to-abuse)

Muistakaa minkä puolueen MEP:pejä siellä istuu.

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 03.10.2014, 14:28:48
Toki parlamentaarikot ovat vaihtuneet tässä välissä, mutta EPP siis täysin kannattaa ihmisten uudelleensijoittelua, joka perustuu kunkin jäsenvaltion laskennalliseen resurssiavaimeen, joka johtaa reiluun taakanjakoon.

Europarlamentti ylipäätään kannattaa sitä. Mepeillä ja maahanmuuttokomissaarilla ei vain ole vielä tarpeeksi valtaa sen toteuttamiseen. Juuri siksi on niin pelottavaa, että suuret puolueet Perussuomalaisia lukuun ottamatta kannattavat EU:n yhteistä turvapaikkapolitiikkaa, jonka mukaan Suomella ei olisi enää sananvaltaa tänne pyrkivien pakolaisten hyväksymisessä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ikuturso - 03.10.2014, 15:02:07
Toki parlamentaarikot ovat vaihtuneet tässä välissä, mutta EPP siis täysin kannattaa ihmisten uudelleensijoittelua, joka perustuu kunkin jäsenvaltion laskennalliseen resurssiavaimeen, joka johtaa reiluun taakanjakoon.

Europarlamentti ylipäätään kannattaa sitä. Mepeillä ja maahanmuuttokomissaarilla ei vain ole vielä tarpeeksi valtaa sen toteuttamiseen. Juuri siksi on niin pelottavaa, että suuret puolueet Perussuomalaisia lukuun ottamatta kannattavat EU:n yhteistä turvapaikkapolitiikkaa, jonka mukaan Suomella ei olisi enää sananvaltaa tänne pyrkivien pakolaisten hyväksymisessä.

Pelottavinta on se, että kansa ei tätä ymmärrä ennen kuin ensimmäinen 20 000 maahanmuuttajaa lähetetään tänne tuon pykälän perusteella.

Oletteko muuten huomanneet, että kun vetoamme aina Dublin-säädökseen, niin siitäkin on tullut Dublin phase II ja tämä taakanjako lienee Dublin phase III tai jotain. Ja tietty omat virkamiehemme ja poliitikkomme sanovat, että tämä on pakko ja väistämätöntä ja kuuluu yhteiseen Eurooppaamme tämä taakanjako, paitsi että:
Lainaus
There are three exceptions to this rule. The Republic of Ireland and the United Kingdom negotiated an opt-out clause and are not bound by all the instruments of the CEAS, although they can decide to opt-in whenever they want. Denmark however, is not party to the CEAS but has opted in to the Dublin Regulation.

-i-
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 03.10.2014, 16:17:37
Odotan todella innolla itseään nuiviksi kutsuvien nimimerkkien EL_SID, Faidros., nollatoleranssi & co kommentteja Eurostoliiton CEAS-suunnitelmaan, joka ainakin oman käsitykseni mukaan on ilman muuta tärkein Suomen maahanmuutopolitiikkaan vaikuttava asia tällä hetkellä.

En kylläkään pidättele hengitystäni odottaessa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 03.10.2014, 16:35:31
Odotan todella innolla itseään nuiviksi kutsuvien nimimerkkien EL_SID, Faidros., nollatoleranssi & co kommentteja Eurostoliiton CEAS-suunnitelmaan, joka ainakin oman käsitykseni mukaan on ilman muuta tärkein Suomen maahanmuutopolitiikkaan vaikuttava asia tällä hetkellä.

En kylläkään pidättele hengitystäni odottaessa.

Et tainnut huomata tätä käsittelevää netsien muistiota, joka jaettiin sähköpostissa heinäkuussa 2012. Siinä analysoitiin, että, mitä hiljempaa CEAS:sta ollaan, niin sitä varmemmin Suomi sitä vastustaa. Jos tästä tehdään jokin aatteellinen kysymys, niin sitä enemmän media ja vihervasemmisto rummuttaa sen puolesta ja haukkuu Suomen nykyisen linjan rasistiseksi ja painostaa muut suuret puolueet CEAS:n taakse. En tiedä, onko tämä oikea strategia, mutta näin on päätetty.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: pw - 03.10.2014, 17:29:02
Odotan todella innolla itseään nuiviksi kutsuvien nimimerkkien EL_SID, Faidros., nollatoleranssi & co kommentteja Eurostoliiton CEAS-suunnitelmaan, joka ainakin oman käsitykseni mukaan on ilman muuta tärkein Suomen maahanmuutopolitiikkaan vaikuttava asia tällä hetkellä.

En kylläkään pidättele hengitystäni odottaessa.

Et tainnut huomata tätä käsittelevää netsien muistiota, joka jaettiin sähköpostissa heinäkuussa 2012. Siinä analysoitiin, että, mitä hiljempaa CEAS:sta ollaan, niin sitä varmemmin Suomi sitä vastustaa. Jos tästä tehdään jokin aatteellinen kysymys, niin sitä enemmän media ja vihervasemmisto rummuttaa sen puolesta ja haukkuu Suomen nykyisen linjan rasistiseksi ja painostaa muut suuret puolueet CEAS:n taakse. En tiedä, onko tämä oikea strategia, mutta näin on päätetty.

Kuka on päättänyt? Strategia on takuuvarmasti väärä. Sehän on selvää että CEAS runnotaan läpi kaikessa hiljaisuudessa koska jos todellisuus iskettäsiin ihmisten eteen niin vastustus olisi varmaa. Kenellekään, fanaattisinta tärähtäneistöä lukuunottamatta, ei tänä päivänä ole epäselvää mihin konkurssikypsällä Suomella on maailmanparannuksessaan varaa. Ei yhtään mihinkään. Edes nykyisiä velvoitteita ei ole mahdollista täyttää.

Media ei tietenkään pukahda aiheesta mitään, mutta onneksi Suomesta on kaksi meppiä Brysselissä jotka voivat tiedottaa. Onkin äärimmäisen tärkeää että JHa ja Terho ovat hereillä. Ylipäätään PS:n puolueena pitäisi ottaa CEAS esille eduskunnassa ja julkisuudessa ja koittaa takoa kansalaisille rautalankaesimerkein mitä tapahtuu jos tai siis kun kymmenien tuhansien heinäsirkkalauma lävähtää jo valmiiksi kuilun partaalla olevan julkisen sektorin kontolle. Asteittaisen sopeuttamisen/purkamisen sijaan koko järjestelmä romahtaa kerrasta. Koululaitos, terveydenhuolto jne. 

Ts. kysymys persuille kuuluu : miksi rumpu ei jo käy?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 03.10.2014, 18:06:52

Kuka on päättänyt?

Sain juuri viestin, että olen kertonut jo nyt liikaa ja siten vahingoittanut organisaatiota. Jos kertoisin enemmän, joutuisin eliminoimaan sinut.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Nuivanlinna - 03.10.2014, 18:23:05
Asteittaisen sopeuttamisen/purkamisen sijaan koko järjestelmä romahtaa kerrasta. Koululaitos, terveydenhuolto jne. 

Ts. kysymys persuille kuuluu : miksi rumpu ei jo käy?

Ei mitään äkkiromahdusta tule....vielä, olemmehan katsos parasta AAA-ryhmää ja velkaa voimme ottaa "vastuista" selvitäksemme.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Pöllämystynyt - 03.10.2014, 19:40:31
Hiljaista on kuin myrskyn edellä. Tässä pohjimmiltaan räikeästi demokratian ja alkuperäisväestön ihmisoikeuksien vastaisessa suunnitelmassa olisi toteutuessaan hyvin merkittävä vakavan yhteiskunnallisen kriisin vaara. Suomen herkässä geopoliittisessa sijainnissa ja tilanteessa, ja pitkään jatketun toisinajattelijoiden vastaisen hysterian lietsonnan jälkeen tällainen yhteiskunnan sisäinen konflikti olisi erittäin vaarallinen.

Jopa kantaväestöä kaikesta syyttelevien monikultturistien ynnä muiden vastaavien homoetnofoobikoiden näkökulmasta pitäisi näyttää selvältä, että tällaisen politiikan aiheuttamat väestönsiirrot aiheuttaisivat valtavia ongelmia ja suoria yhteenottojakin. He tosin oppinsa mukaan syyttäisivät kaikesta kantaväestön rasismia, mutta yhtä kaikki heidänkin luulisi ymmärtävän tällaisen politiikan olevan erittäin vaarallista.

Tässä on kyse demokraattisen yhteiskuntajärjestyksen olemassaolostakin, niin pahoin väestönsiirtokonfliktit, islamismi, monikultturistien järjestämät mielipidevainot ja tulokkaiden segregaatio ja rinnakkaisyhteiskunnat sitä voisivat uhata Suomen vielä ollessa näinkin heikossa asemassa liittoutumattomana ja jo valmiiksi eripuraisena.

Venäjä tuskin haluaisi rajojensa lähelle Ruotsin tai Britannian lähiöiden tyyppisiä islamistisen terrorismin pesäkkeitä, joten silläkin olisi intressi puuttua tällaiseen politiikkaan, joka niitä vääjäämättömästi alkaisi muodostaa. Venäjä saattaisi haluta jopa tulla "vapauttamaan" Suomen tästä hirviömäisestä politiikasta, toki omaa etuaan ajaen. Suomalaiset etnisyytenä pelastuisivat väestönmuokkaukselta, ainakin tältä kampanjalta, mutta palkkioksi Venäjä kenties haluaisi ylimmän vallan maassa tai osassa siitä. Katsoipa asiaa melkein miltä tahansa näkökannalta, niin tällainen politiikka olisi se "viimeinen virhe".
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 06.10.2014, 11:30:29
Towards Refugee Burden-Sharing in the European Union - State Interests and Policy Options (https://www.utexas.edu/cola/centers/european_studies/_files/PDF/immigration-policy-conference/thielemann.pdf) (pdf)

Lainaus
Eiko R. Thielemann
Department of Government & European Institute
London School of Economics and Political Science
&
Center for Comparative Immigration Studies
University of California, San Diego

Lainaus
Abstract:
The European Union plays an increasingly influential role in the management of
asylum-seekers and refugees in Europe. This paper addresses the question why
European states have decided to cooperate in this policy area and why they have been
prepared to give EU institutions an increasingly greater role in this process. It seeks
to offer new insights into the motivation for international cooperation in this area,
analyzing in particular how the EU has sought to address collective action problems
that states are faced with when dealing with asylum seekers. EU asylum policies
initiatives both before and after 9/11 will be scrutinized and assessed in view of their
success in providing an effective and equitable regulatory framework for asylum and
refugee policy in Europe.

Lainaus
Introduction... 2
How (un)equal is the current distribution of Refugee Burdens? ................................. 4
Why are Refugee Burdens unequally distributed?...................................................... 6
Free-Riding Opportunities ..................................................................................... 6
Willingness to Accept Burdens.............................................................................. 6
Structural Pull Factors ........................................................................................... 8
What factors are driving burden-sharing initiatives? .................................................. 9
Norm-based motivations.......................................................................................10
Interest-based motivations ....................................................................................12
What kind of burden-sharing regime?.......................................................................15
Policy Harmonisation ...........................................................................................15
Hard Quotas ...15
Market Mechanisms .............................................................................................18
Conclusion ...22

Lainaus
The first explicit
references to such burden-sharing ambitions were made by EU ministers responsible
for asylum and immigration at their meeting of 30 November and 1 December 1992

(not published in the Official Journal of the European Union (OJ) but reprinted in
17UNHCR 1995). These deliberations led to a German Presidency Draft Council
Resolution on Burden-sharing in July 1994
(Council Document 7773/94 ASIM 124).
This proposal foresaw the reception of refugees according to a key which was based
on three criteria which were given equal weight (population size, size of Member
State territory and GDP)
. 29 The centrepiece of the German draft foresaw the
introduction of a compulsory resettlement mechanism. The text of the proposal
stated: ‘Where the numbers admitted by a Member State exceed its indicative figure [
], other Member States which have not yet reached their indicative figure [ ] will
accept persons from the first State.’ Perhaps unsurprisingly, however, this proposal
did not find the necessary support in the Council.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 14.10.2014, 15:56:32
Saksa on nyt virallisestikin kääntänyt takkinsa pakolaiskiintiöiden suhteen. Saksan sisäministeri Thomas de Maizere liputti EU:n sisäministerikokouksessa avoimesti EU-maiden pakolaiskiintiöiden puolesta.

Lainaus
Europe at risk of 'huge number' of returning jihadist fighters
...
Kerchove, EU interior ministers and home affairs commissioner Cecilia Malmstrom met in Luxembourg to address the emerging security threat.
...
“There are many countries in the European Union today who receive basically no refugees or asylum seekers,” said EU commissioner for home affairs Cecilia Malmstrom.

The EU document notes that use of relocation should remain voluntary.

But the lack of solidarity from other member states has caused annoyance, with some calling upon a system of quotas.

Germany, for its part, is pushing for a quota system based on population size.

“We have to agree on the quotas, for example by population size. Then we would have to ensure that those countries that are over their quota get some relief,” said Germany’s interior minister Thomas de Maizere.
EUobserver (http://euobserver.com/justice/125996) 10.10.2014

Lisäksi Saksa, Ranska, Espanja, Iso-Britannia ja Puola vaativat EU-komissiolle osoittamassaan yhteisessä kirjeessä EU-maita ottamaan vastaan toisten EU-maiden pikakäsittelyssä hyväksyttyjä turvapaikanhakijoita rasitetuimpien jäsenmaiden taakan helpottamiseksi. Itävalta on ilmoittanut olevansa kiintiöiden takana, samoin Sveitsi.

Zeit Online: Widerstand gegen de Maizières Pläne zur Flüchtlingsquote (http://www.zeit.de/politik/ausland/2014-10/eu-fluechtlinge-quote-streit) 9.10.2014

Ei mainintaa suomalaisissa tiedotusvälineissä. Tänään Suomen Pakolaisavun edustajat rauhoittelivat suomalaisia Turun Sanomissa (http://www.ts.fi/mielipiteet/lukijoilta/687990/Kehitysyhteistyo+ehkaisee+pakolaisuutta) toteamalla suunnitelluista pakolaiskiintiöistä, että "toimenpiteisiin ei ole ryhdytty, eikä aloitetta turvapaikanhakijoiden sijoituksesta tasaisemmin jäsenvaltioihin ole."
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 14.10.2014, 22:52:21
Tänään Suomen Pakolaisavun edustajat rauhoittelivat suomalaisia Turun Sanomissa (http://www.ts.fi/mielipiteet/lukijoilta/687990/Kehitysyhteistyo+ehkaisee+pakolaisuutta) toteamalla suunnitelluista pakolaiskiintiöistä, että "toimenpiteisiin ei ole ryhdytty, eikä aloitetta turvapaikanhakijoiden sijoituksesta tasaisemmin jäsenvaltioihin ole."

Jotenkin minulla on sellainen olo, ettei Pakolaisavussa uskota taakanjaon toteutumiseen. Ja jos näin sattuisi käymään, siellä oltaisiin aidosti yhtä kauhuissaan kuin Hommassakin ollaan, mikäli Suomeen ruvettaisiin yhtäkkiä siirtämään tuhansia ja taas tuhansia turvapaikanhakijoita taakanjaon nimissä. Tai sitten ei. Kovin huolettomilta Pakolaisavun toiminnanjohtaja ja puheenjohtaja kuitenkin kuulostavat. Vaikka olen itse todennut useammin kuin kerran, miten CEASin pitäisi olla Suomen ykköshuolenaihe Venäjään verrattuna, silti jopa minusta itsestäni ajatus taakanjaosta tuntuu absurdilta. Niin, siis absurdilta kyllä mutta ei lainkaan epätodelliselta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 14.10.2014, 23:21:54
Jotenkin minulla on sellainen olo, ettei Pakolaisavussa uskota taakanjaon toteutumiseen. Ja jos näin sattuisi käymään, siellä oltaisiin aidosti yhtä kauhuissaan kuin Hommassakin ollaan, mikäli Suomeen ruvettaisiin yhtäkkiä siirtämään tuhansia ja taas tuhansia turvapaikanhakijoita taakanjaon nimissä.

Eiväthän nuo oman kertomansa (http://www.pakolaisapu.fi/fi/tietoa/uutiset/item/846-pakolaisapu-vastaa-maria-lohelalle-ps.html) mukaan olleet vielä pari viikkoa sitten edes kuulleet "puhuttavan mitään pinta-alasta tai asukastiheydestä taakanjaon kriteereinä". Tuskin olisivat kauhuissaan, sillä tuhansia ja tuhansia turvapaikanhakijoitahan Pakolaisapu on jatkuvasti Suomeen kinunnut. Eivät haluaisi millään luopua edes turvapaikkatutkinnassa hylätyistä turvapaikanhakijoista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 14.10.2014, 23:40:24
Eiväthän nuo oman kertomansa (http://www.pakolaisapu.fi/fi/tietoa/uutiset/item/846-pakolaisapu-vastaa-maria-lohelalle-ps.html) mukaan olleet vielä pari viikkoa sitten edes kuulleet "puhuttavan mitään pinta-alasta tai asukastiheydestä taakanjaon kriteereinä". Tuskin olisivat kauhuissaan, sillä tuhansia ja tuhansia turvapaikanhakijoitahan Pakolaisapu on jatkuvasti Suomeen kinunnut. Eivät haluaisi millään luopua edes turvapaikkatutkinnassa hylätyistä turvapaikanhakijoista.

Eivät tosiaan oman kertomansa mukaan olleet edes kuulleet. Epäilin kyllä tämänkin väitteen todenmukaisuutta. Mutta voi hyvin olla, että olen liian naiivi ja uskon Pakolaisavunkin olevan niin naiivi ja uskovan, että mitään jättiyllätyksiä ei ole tulossa ja kaikki menee myös jatkossa niin kuin on tähänkin asti mennyt. Näitä yksittäisiä förbomeja toki on, mutta kuuluuko entinen kansanedustaja Maija Perho heihin? En tosiaan tiedä, mutta minua kauhistuttaa EU-parlamentin viisivuotiskausi monessa mielessä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 19.10.2014, 23:49:20
Välimeren maat ja maahanmuuttokomissaari Cecilia Malmström ovat ajaneet turvapaikanhaun mahdollistavien vastaanottokeskusten perustamista Pohjois-Afrikkaan ja maailman pakolaisleireille. Malmströmin mukaan suunnitelma edellyttäisi kuitenkin ensin EU-maille määrättyjä turvapaikanhakijakiintiöitä. Aloitteilla ei ole tähän asti ollut laajempaa kannatusta.

Lainaus
One policy option, an idea that has floated around the European Union for several decades, is to externalize or “offshore” the processing of asylum seekers before they reach European borders. The policy rests on the assumption of a safe place beyond EU borders where humanitarian migrants can wait while their applications are processed, lessening pressure to make a crossing that often spells danger and death. A recent IOM report found that over the last 20 years, Europe appears to have recorded the greatest number of reported migrant deaths, which the organization estimated have reached more than 40,000 globally since 2000.

With the spotlight on migrants arriving via ship and those intercepted at sea, discussion of building processing centers abroad took on new urgency. Greece, which held the EU presidency for the first half of 2014, and Italy, which assumed the presidency in July 2014, favor migrant processing centers in North Africa; in May, Italian Premier Matteo Renzi called on the United Nations to set up such centers in Libya. A resolution passed by the Parliamentary Assembly of the Council of Europe in June included language to consider the establishment of camps in North Africa, although this was later amended. European Commissioner for Home Affairs Cecilia Malmström suggested several offshore policy options, including handling asylum requests at consulates established in refugee camps. “But those proposals have not gone down very well,” she said. The concept has garnered little support beyond the southern Member States facing the greatest influx, in large measure because before offshore processing could begin, countries would have to commit to the numbers of refugees they would be willing to accept—and because of skepticism that off-shore processing of limited numbers would stop the boat arrivals. In raising the idea of opening an EU asylum processing center beyond Europe, Malmström advocated for the implementation of a quota system for allocating resettled refugees among Member States before any kind of external processing could be put in place.
Zara Rabinovitch: Pushing Out the Boundaries of Humanitarian Screening with In-Country and Offshore Processing (http://investorshub.advfn.com/boards/read_msg.aspx?message_id=107332128) 16.10.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 23.10.2014, 10:23:45
Lainaus
Perussuomalaiset eivät halua jakaa turvapaikanhakijoita

Perussuomalaiset vastustavat ajatusta siitä, että EU jakaisi turvapaikanhakijat. Dublin 3 -sopimuksessa, joka aiotaan sisällyttää lainsäädäntöön, ei ole enää niin tärkeää, missä maassa turvapaikanhakijan asia käsitellään. Pääasia on, että asia käsitellään. Perussuomalaiset eivät saaneet näkemyksilleen minkäänlaista tukea muilta eduskunnan suuressa valiokunnassa. (käännös)

[...]
Svenska Yle: Sannfinländarna vill inte dela på asylansökningar (http://svenska.yle.fi/artikel/2014/10/23/sannfinlandarna-vill-inte-dela-pa-asylansokningar) 23.10.2014

edit: Ruotsinkielisessä tekstissä puhutaan turvapaikkahakemusten jakamisesta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: huhha - 23.10.2014, 17:10:27
Towards Refugee Burden-Sharing in the European Union - State Interests and Policy Options (https://www.utexas.edu/cola/centers/european_studies/_files/PDF/immigration-policy-conference/thielemann.pdf) (pdf)

Lainaus
Introduction... 2
How (un)equal is the current distribution of Refugee Burdens? ................................. 4
Why are Refugee Burdens unequally distributed?...................................................... 6
Free-Riding Opportunities ..................................................................................... 6
Willingness to Accept Burdens.............................................................................. 6
---

Joo. Tässä vaan vapaamatkustetaan, kun Ruotsi ja Saksa luovat turvallisuutta ja yhteishyvää maailmaan ja erityisesti Schengen-alueelle. Juu.

Muuten: Joulunpyhiksi pitäisi olla jotain mistä jauhaa sukulaisten kanssa, tulevia vaaleja ajatellen. Esiin nostettavia ongelmia ja aiheita on kyllä tullut esiin kuin mannaa taivaasta, mutta EU:n turvapaikkajärjestelmä pitäisi ehdottomasti saada myös keskusteluun. Persuuut?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: metapenn - 23.10.2014, 23:37:40
Lainaus
Perussuomalaiset eivät halua jakaa turvapaikanhakijoita

Perussuomalaiset vastustavat ajatusta siitä, että EU jakaisi turvapaikanhakijat. Dublin 3 -sopimuksessa, joka aiotaan sisällyttää lainsäädäntöön, ei ole enää niin tärkeää, missä maassa turvapaikanhakijan asia käsitellään. Pääasia on, että asia käsitellään. Perussuomalaiset eivät saaneet näkemyksilleen minkäänlaista tukea muilta eduskunnan suuressa valiokunnassa. (käännös)

[...]
Svenska Yle: Sannfinländarna vill inte dela på asylansökningar (http://svenska.yle.fi/artikel/2014/10/23/sannfinlandarna-vill-inte-dela-pa-asylansokningar) 23.10.2014

Tuon jutun itsekin aamusella kauhistellen lukaisin. Hyvä, että Perussuomalaisten kanta tuli selvästi esille ja nimenomaan ainoana vaihtoehtona.

Muiden puolueiden kantaa edusti tällä kertaa Silvia Modig (vas.), joka lähinnä käytti "Ajatelkaa edes lapsia" -tyyppistä argumenttia.

Harmi, ettei suomenkielisellä Ylen puolella taida olla asiasta mitään.

Selasin äsken hetken nettiä löytääkseni jotain tilastoa, paljonko maailmassa niitä lapsia, eli alle 18-vuotiaita on, mutta pikaisesti löysin vain tietoa alle 15-vuotiaista. Näytti siltä, että Afrikan maissa on järjestään n. 40 % väestöstä alle 15-vuotiaita, jos nyt kiireessä oikein ymmärsin. Eli pelkästään Afrikasta löytyisi n. 400 000 MILJOONAA potentiaalista yksintulevaa lasta (ensamkommande barn). Ja siihen Lähi-itä sitten päälle.

Yle Svenskassa (vai kuuluuko sanoa Svenska Ylessä?) on lähes päivittäin uutisjuttuja maahanmuuttoon liittyvistä aiheista. Useimmiten vaan se näkökulma on niin yksipuolinen, etten jaksa lukea.

Positiivista on se, että hämmästyttävän usein jutuissa on kommentointimahdollisuus, toisin kuin suomenkielisellä puolella. En itse ole kokeillut moderoinnin tasoa, mutta ilahduttavan usein on nuiviakin kommentteja päässyt läpi.

Itse CEAS-möhköstä vielä sen verran, että kyllä pitäisi Perussuomalaisten tästä tehdä vyyhti rautalankaa ja jaella sen avulla kansan pariin tiivistettyä tietoa EU:n suunnitelmista. Ei kauhukuvien maalaamista, vaan käytännön esimerkeillä valaisten, mitä on todellisuus. Maaperä kun lie kantaväestössä nyt otollinen, kun jo näillä "vähäisillä" mamumäärilläkin noita ISIS-heppujakin löytyy jo vähän joka kulmilta (vaikka osa han-suomalaisia käännynnäisiä olisikin).

EDIT: Heh, lisätty nollia; luvut ovat vaikeita!  :-[
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: crissaegrim - 24.10.2014, 16:42:19
Onko suomenkielisissä medioissa mainittu asiasta?
Nyt muut puolueet niitä vastauksia:

1) Miksi ette halua, että Suomi saa itse päättää asioistaan; miksi kannatatte liittovaltiota?
2) Miksi haluatte tänne moninkertaisen määrän turvapaikanhakijoita.

Eiköhän tämä tule menemään hissun kissun läpi, koska edellä mainittuja kysymyksiä välttelee kuka tahansa fiksu poliitikko (pl. tietenkin persut, jotka uskaltavat sanoa kantansa): todella harva äänestäjä oikeasti kannattaa tuollaista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kemolitor - 25.10.2014, 11:52:03
Sisäministeriön Monitori-lehden sivuilla erityisasiantuntija Tuomas Koljonen kertoo tämän hetken tilanteesta:

Lainaus
EU:n maahanmuuttopolitiikkaa tehdään pitkäjänteisesti

Euroopan yhteistä turvapaikkajärjestelmää koskeva EU-lainsäädäntö on saatu hyväksyttyä. Onko se muuttanut mitään?

Paineet EU:n rajoilla kovenevat ja strategia-asiakirjojen pino kasvaa. Sisäministeriön erityisasiantuntija Tuomas Koljosen mukaan asiat kuitenkin etenevät. Ei harppauksittain, mutta oikeaan suuntaan.

– Hankalaa on etenkin se, että vaikka lainsäädäntö ja strategiat olisivatkin erityisesti EU-tasolla kunnossa, käytännössä asiat voivat olla paljon heikommalla tolalla.
-----
Tulevaisuuden vaikea ennustettavuus ja jäsenmaiden keskinäiset eroavaisuudet tekevät niin lakien harmonisoinnista kuin direktiivien toimeenpanosta työlästä. Esimerkiksi CEASista eli Euroopan yhteistä turvapaikkajärjestelmästä käytiin tiukkoja neuvotteluja vuosikausien ajan ennen kuin niin sanottu CEAS II -vaiheen lainsäädäntö saatiin lopulta hyväksyttyä. Nyt haasteena on se, kuinka CEASin toisen vaiheen lainsäädäntö saadaan tehokkaasti saatettua osaksi jäsenmaiden kansallisia lainsäädäntöjä, kun joillakin jäsenmailla on tekemistä vielä ensimmäisen vaiheenkin kanssa.
-----

Maahanmuuttopaineet ykkösteemana

Tuomas Koljonen on seurannut EU:n maahanmuuttopolitiikkaa tiiviisti vuosikymmenen ajan, ja kestoteemana on koko tämän ajan ollut EU:n toimet maahanmuuttopaineeseen vastaamiseksi.

– Kyse ei ole pelkästään laittomasta maahanmuutosta, vaan niin sanotusta mixed flowsta, eli muuttovirrat koostuvat sekä turvapaikanhakijoista että toisaalta paremman elämän toivossa Eurooppaan pyrkivistä henkilöistä, joilla ei välttämättä ole mitään laillista perustetta jäädä EU:hun.

Euroopan unioni perusti Lampedusan onnettomuuden jälkeen Välimeren toimintaryhmän, johon osallistuvat kaikki EU:n jäsenmaat sekä virastoista esimerkiksi Frontex ja EASO. Nyt, Italian EU-puheenjohtajuuskaudella, on laadittu uusi strategia-asiakirja, jonka tarkoituksena on konkretisoida Välimeren toimintaryhmän työtä.

– Haasteena on erityisesti vuoropuhelun tiivistäminen kolmansien maiden eli pakolaisten lähtö- ja kauttakulkumaiden kanssa. Kolmansien maiden yhteistyöhalukkuus vaihtelee. Eräiden akuutisti tärkeiden maiden sitouttaminen yhteistyöhön EU-maiden kanssa on hankalaa jo siksi, että niissä ei ole välttämättä edes perushallintorakenteet kunnossa.
-----
Euroopan komissio haluaa edistää laillista maahanmuuttoa

Kun puhutaan laillisesta maahanmuutosta, Tuomas Koljosen mukaan Euroopan komission kanta on selvä: sitä pidetään tärkeänä. Uusi maahanmuuttokomissaari, kreikkalainen Dimitris Avramopoulos, painottaa varsinkin erityisosaamista omaavien maahanmuuttajien merkitystä.
-----
Olennaista Koljosen mielestä on tiedostaa, että laillista maahanmuuttoa lisäämällä ei välttämättä suoraan vähennetä laitonta maahanmuuttoa, vaikka julkisessa keskustelussa joskus niin annetaankin ymmärtää. EU:n on nykytilanteessa päättäväisesti torjuttava laitonta maahanmuuttoa ja varmistettava suojelun antaminen sitä tarvitseville. Samalla tämän rinnalla on edistettävä EU:n talouskasvun kannalta tärkeiden ryhmien laillista maahanmuuttoa.

Suojelua tarvitsevat saavat suojelua

Periaatteellisella tasolla EU:lla on selkeä kanta maahanmuuttoon: Ihmisiä, jotka tarvitsevat suojelua, suojellaan. Mutta niitä, joilla ei ole perusteita tulla Eurooppaan, ei lähtökohtaisesti ole syytä vastaanottaa. Niinpä EU:ssa paneudutaan nyt myös palauttamispolitiikan tehostamiseen.

EU-tasolla palauttamispäätöksiä tehdään noin 500 000 kappaletta vuodessa. Vain noin reilu kolmasosa pannaan täytäntöön. Palautuspolitiikan tehostaminen kuului Suomen prioriteetteihin uusien oikeus- ja sisäasioiden strategisten linjojen valmistelussa. Sen edellytyksenä on palauttamiskysymysten järjestelmällinen käsittely EU:n kumppanien kanssa, takaisinottosopimusten toimivuuden varmistaminen ja takaisinotosta sopiminen EU:lle tärkeiden maiden kanssa, Tuomas Koljonen toteaa.

Koko juttu:
Monitori: EU:n maahanmuuttopolitiikkaa tehdään pitkäjänteisesti (http://www.intermin.fi/fi/ajankohtaista/monitori-lehti/1/0/eu_n_maahanmuuttopolitiikkaa_tehdaan_pitkajanteisesti_56258?language=fi)

Jos puolesta miljoonasta palautuspäätöksestä reilu kolmannes pannaan vuosittain täytäntöön, niin entäs ne noin 300 000 ihmistä vuosittain, joiden kohdalla palautuspäätöstä ei panna täytäntöön, mitä heille sitten tapahtuu ja miksei näitä päätöksiä panna täytäntöön kaikkien kohdalla?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 02.11.2014, 10:29:24
EU-komission uusi puheenjohtaja Jean-Claude Juncker haluaa EU:lle vahvan yhteisen turvapaikkajärjestelmän, josta on poistettu kansalliset erityispiirteet, koska humanitaarinen imperatiivi.

Lainaus
Jean-Claude Juncker: Towards a New Policy on Migration

The recent terrible events in the Mediterranean have shown us that Europe needs to manage migration better, in all aspects. This is first of all a humanitarian imperative. I am convinced that we must work closely together in a spirit of solidarity to ensure that situations such as the one in Lampedusa never arise again.

On the basis of our shared values, we need to protect those in need through a strong common asylum policy. The newly agreed common asylum system has to be fully implemented, and divergences in national implementation removed.
10 Priorities - Migration (http://ec.europa.eu/about/juncker-commission/priorities/08/index_en.htm) 8.8.2014

Juncker ei mainitse tavoiteohjelmassaan jäsenmaille määrättyjä pakolaiskiintiöitä, mutta yhteinen EU-johtoinen turvapaikkajärjestelmä ei voi toimia ilman turvapaikanhakijoiden siirtoja jäsenmaista toisiin.

Lainaus
Klaus F. Zimmermann: Europe’s refugee tragedy: about responsibility, work and fair burden-sharing

In a bold statement before the European Parliament, the EU Commission’s new President Jean-Claude Juncker stressed that European core values must also be respected when it comes to asylum policy (http://ec.europa.eu/about/juncker-commission/priorities/08/index_en.htm).

[...]

While new heads, consolidated responsibilities and strong speeches do not necessarily indicate a genuine change in policy, now is the chance to finally establish a European migration strategy that is no longer based on defense and national self-interest, but on the principle of shared responsibility.

[...]

The first step must be to agree on a transparent quota system guaranteeing a balanced distribution of asylum-seekers across EU member countries. Countries like Sweden and Germany have accepted above-average numbers of asylum applications over the past years, while France and the UK have been rather reluctant. The definition of a “fair share” must account for the economic strength of each country.
Institute for the Study of Labor (IZA) (http://newsroom.iza.org/en/2014/10/31/europes-refugee-tragedy-about-responsibility-work-and-fair-burden-sharing/) 31.10.2014

Ylhäältä sanellut kiintiöt voidaan verhota vapaaehtoisiksi käymällä kiintiöistä huutokauppaa. Joko Suomi ottaisi vapaaehtoisesti vastaan 20 000 turvapaikanhakijaa esimerkiksi Ruotsista tai maksaisi Ruotsille 20 000 turvapaikanhakijan vastaanoton kustannukset.

Lainaus
The current EU Asylum policy is widely seen as ineffective and unfair. We propose an EU-wide market for tradable quotas on both refugees and asylum-seekers coupled with a matching mechanism linking countries' and migrants' preferences. We show that the proposed system can go a long way towards addressing the shortcomings of the existing system. We illustrate this claim using the recent problems regarding relocation faced by the European Relocation from Malta (EUREMA) program.
Robert Schuman Centre for Advanced Studies/Migration Policy Centre: Tradable Refugee-admission Quotas: a Policy Proposal to Reform the EU Asylum Policy (http://cadmus.eui.eu/bitstream/handle/1814/33097/RSCAS_2014_101.pdf?sequence=1) 10/2014 (pdf)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 02.11.2014, 10:48:10
^ Onko suomalaisille tullut joku kollektiivinen aivovamma vai miksi tästä ei puhuta mitään? Siis, että me maksaisimme ruotsalaisten sosiaaliturviskustannuksia? Ei jumalauta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: guest3656 - 02.11.2014, 10:54:23
^ Onko suomalaisille tullut joku kollektiivinen aivovamma vai miksi tästä ei puhuta mitään? Siis, että me maksaisimme ruotsalaisten sosiaaliturviskustannuksia? Ei jumalauta.

Miksi Halla-ahokin on tästä hiljaa? Ainakin itse äänestin häntä sen vuoksi, että hän myös raportoisi EU:n aikomuksista äänestäjilleen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lahti-Saloranta - 02.11.2014, 11:22:08
Miksi Halla-ahokin on tästä hiljaa? Ainakin itse äänestin häntä sen vuoksi, että hän myös raportoisi EU:n aikomuksista äänestäjilleen.
Luulen että kuulemme tästä lähempänä vaaleja,
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 03.11.2014, 01:35:29
Lainaus
The process of harmonisation in the field of asylum started in Tampere in 1999, where EU leaders committed to establish a Common European Asylum System (CEAS).

2013-06-12 European Parliament adopts Common European Asylum System (CEAS (http://www.emnbelgium.be/news/european-parliament-adopts-common-european-asylum-system-ceas)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 03.11.2014, 13:34:59
Sisäministeriön Monitori-lehden sivuilla erityisasiantuntija Tuomas Koljonen kertoo tämän hetken tilanteesta:
Olennaista Koljosen mielestä on tiedostaa, että laillista maahanmuuttoa lisäämällä ei välttämättä suoraan vähennetä laitonta maahanmuuttoa, vaikka julkisessa keskustelussa joskus niin annetaankin ymmärtää. Monitori: EU:n maahanmuuttopolitiikkaa tehdään pitkäjänteisesti (http://www.intermin.fi/fi/ajankohtaista/monitori-lehti/1/0/eu_n_maahanmuuttopolitiikkaa_tehdaan_pitkajanteisesti_56258?language=fi)

Tämähän on yksi yleisimmin julkisuudessa toistettuja väittämiä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 03.11.2014, 13:48:57
Olennaista Koljosen mielestä on tiedostaa, että laillista maahanmuuttoa lisäämällä ei välttämättä suoraan vähennetä laitonta maahanmuuttoa, vaikka julkisessa keskustelussa joskus niin annetaankin ymmärtää.

Tämähän on yksi yleisimmin julkisuudessa toistettuja väittämiä.

On, mutta se on vain poliitikkojen ja pakolaisjärjestöjen hokema slogan. Alan tutkijoiden mukaan laillisen maahanmuuton lisääminen lisää myös laitonta maahanmuuttoa, kuten loogista onkin (kontaktit, rahoitus jne.).
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Lalli IsoTalo - 03.11.2014, 13:51:23
EU-komission uusi puheenjohtaja Jean-Claude Juncker haluaa EU:lle vahvan yhteisen turvapaikkajärjestelmän, josta on poistettu kansalliset erityispiirteet, koska humanitaarinen imperatiivi.

Lainaus
Jean-Claude Juncker: Towards a New Policy on Migration

The recent terrible events in the Mediterranean have shown us that Europe needs to manage migration better, in all aspects. This is first of all a humanitarian imperative. I am convinced that we must work closely together in a spirit of solidarity to ensure that situations such as the one in Lampedusa never arise again.
Robert Schuman Centre for Advanced Studies/Migration Policy Centre: Tradable Refugee-admission Quotas: a Policy Proposal to Reform the EU Asylum Policy (http://cadmus.eui.eu/bitstream/handle/1814/33097/RSCAS_2014_101.pdf?sequence=1) 10/2014 (pdf)

Jos Wikipediaan on uskominen, humanitaarisiin periaatteisiin luetaan se, että luonnonkatastrofien ja sotien uhreista huolehditaan. Jean-Claude Juncker  mainitsee humanitaarisesta pakosta/imperatiivista esimerkkinä Lampedusan, joka ei ole kumpikaan (vaan esimerkki laittomien Eurooppaan pyrkijöiden kauttakulkupisteestä).

Junckerin humanitaarinen imperatiivi ei kestä päivänvaloa. Kyseessä on immigraatioimperatiivi, Euroopan pakkotäyttäminen afrikkalaisilla.

Lainaus käyttäjältä: http://en.wikipedia.org/wiki/Humanitarian_principles
Here humanitarian pertains to the practice of saving lives and alleviating suffering. It is usually related to emergency response (also called humanitarian response) whether in the case of a natural disaster or a man-made disaster such as war or other armed conflict.

Lainaus käyttäjältä: http://en.wikipedia.org/wiki/Lampedusa
Since the early 2000s, Lampedusa has become a prime transit point for immigrants from Africa, the Middle East and Asia wanting to enter Europe.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Onkko - 03.11.2014, 14:11:41
EU-komission uusi puheenjohtaja Jean-Claude Juncker haluaa EU:lle vahvan yhteisen turvapaikkajärjestelmän, josta on poistettu kansalliset erityispiirteet, koska humanitaarinen imperatiivi.

Lainaus
Jean-Claude Juncker: Towards a New Policy on Migration

The recent terrible events in the Mediterranean have shown us that Europe needs to manage migration better, in all aspects. This is first of all a humanitarian imperative. I am convinced that we must work closely together in a spirit of solidarity to ensure that situations such as the one in Lampedusa never arise again.
Robert Schuman Centre for Advanced Studies/Migration Policy Centre: Tradable Refugee-admission Quotas: a Policy Proposal to Reform the EU Asylum Policy (http://cadmus.eui.eu/bitstream/handle/1814/33097/RSCAS_2014_101.pdf?sequence=1) 10/2014 (pdf)

Jos Wikipediaan on uskominen, humanitaarisiin periaatteisiin luetaan se, että luonnonkatastrofien ja sotien uhreista huolehditaan. Jean-Claude Juncker  mainitsee humanitaarisesta pakosta/imperatiivista esimerkkinä Lampedusan, joka ei ole kumpikaan (vaan esimerkki laittomien Eurooppaan pyrkijöiden kauttakulkupisteestä).

Junckerin humanitaarinen imperatiivi ei kestä päivänvaloa. Kyseessä on immigraatioimperatiivi, Euroopan pakkotäyttäminen afrikkalaisilla.

Lainaus käyttäjältä: http://en.wikipedia.org/wiki/Humanitarian_principles
Here humanitarian pertains to the practice of saving lives and alleviating suffering. It is usually related to emergency response (also called humanitarian response) whether in the case of a natural disaster or a man-made disaster such as war or other armed conflict.

Lainaus käyttäjältä: http://en.wikipedia.org/wiki/Lampedusa
Since the early 2000s, Lampedusa has become a prime transit point for immigrants from Africa, the Middle East and Asia wanting to enter Europe.

Tavallaanhan tuo on man made disaster kun sallitaan/rohkaistaan/hyväksytään ylikansoittuminen joka johtaa siihen että vituiks män. Eri asia on että onko tuo nyt aivan alkuperäisen tekstin tarkoitus että muutkin valtiot tuhotaan kun muutamilla menee päin ....
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tragedian synty - 05.11.2014, 11:38:01
Terveisiä pimeyden ytimestä. Osallistuin juuri Tampere-talolla Euroopan komission järjestämään seminaariin "A Europe that attracts and protects – migration and asylum policies". Puhujina Marco del Panta (Italian ulkoministeriön maahanmuuttoa käsittelevän osaston varajohtaja), Peter Bosch (Euroopan komission virkamies, aiemmin Cecilia Malmströmin alaisena), Jorma Vuorio (Suomen sisäministeriön maahanmuutto-osaston osastopäällikkö) sekä Mark Camilleri (European Asylum Support Office, Policy and Inter-Institutional Relations Coordinator (en edes yritä suomentaa)).

Italialainen kertoi Italian puheenjohtajakauden maahanmuuttotavoitteista. Erityisen kiinnostukseni ja närkästykseni herätti hänen selittelynsä, että mitään ei ole mahdollista tehdä Välimeren yli Italiaan suuntautuvaan väestövyöryyn. Espanjaan ja Kreikkaan tulevat laittomat maahanmuuttajat on mahdollista tarpeen vaatiessa palauttaa Marokkoon ja Turkkiin, mutta Libyan kanssa ei mikään yhteistyö ole mahdollista. Syy on se, ettei Libya nykyisellään kunnioita ihmisoikeuksia. Mitään suunnitelmaa Libyan painostamisesta tai sotilaallisesta interventiosta sinne ei edes vihjattu. Mies ei tainnut ollenkaan ymmärtää, että tunteiden vallassa aloitettu meripelastusoperaatio Lampedusan komedian tragedian jälkeen vain pahentaa tilannetta, kun yhä useammat rohkeavat lähteä Välimeren yli purkeissaan.

Peter Bosch oli positiivinen yllätys, etenkin lopuksi. Hänen puheenvuoronsa alkupuolella ehdin jo diagnosoida hänet imbesilliksi, mutta hän taisi telepaattisesti saada tietää siitä, koska kohensi ulosantiaan rajusti. Hän ymmärsi demografiset ongelmat, kuten sen, että muutaman vuosikymmenen kuluttua Afrikassa on kolme kertaa enemmän väestöä kuin Euroopassa. Hän peräänkuulutti Yhdysvaltain, Kanadan ja Australian käyttämää järjestelmää, jossa oikeasti osaavia ihmisiä houkutellaan Eurooppaan esimerkiksi kolmansien maiden yliopistoista, eikä tuntunut pitävän maahanmuuttoa arvokkaana sinänsä. Tosin miinusta annan siitä, että hän ei keskittynyt demografisiin asioihin Euroopassa. Talous hallitsi näkökulmaa, ei se, että eurooppalaiset kansat ja eurooppalainen kulttuuri ovat vaarassa kadota, kun muukalaiset tulevat ja lisääntyvät täällä enemmän. Ehdotukset lainsäädännöllisiksi yksityiskohdiksi olivat järkevän oloisia, mutta ne eivät minua juuri kiinnostaneet, minähän olen enemmän kiinnostunut siitä, kuinka paljon ei-eurooppalaisia tänne tulee.

Kahdesta muusta puhujasta ei oikeastaan ole paljon sanottavaa. Suomalainen puhui niin monotonisesti, etten rekisteröinyt puheesta juuri mitään. Viimeinen paasasi lähinnä solidaarisuudesta, solidaarisuudesta ja solidaarisuudesta, kuten tittelinsä antoi odottaakin: "Kenen leipiä syöt, sen lauluja laulat."

E: typo.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: qwerty - 06.11.2014, 12:58:27
Tämä liittynee tähän?

Eduskunnan päiväjärjestys TORSTAINA 6. MARRASKUUTA 2014

Hallituksen esitys eduskunnalle laiksi ulkomaalaislain muuttamisesta
Hallituksen esitys  HE 218/2014 vp (http://217.71.145.20/TRIPviewer/show.asp?tunniste=HE+218/2014&base=erhe&palvelin=www.eduskunta.fi&f=WORD)

"Hieman" liian lakiteknistä näin äkkivilkaisulla. Joku koukku tässä on pakko olla, miksi muuten lähdettäisiin muuttamaan tällaista kasaa?

muutetaan ulkomaalaislain (301/2004) 95, 95 a, 97, 97 a, 97 b, 99, 101–105, 147 a, 199 ja 201 §,
sellaisina kuin niistä ovat 95 a § ja 97 b § laissa 432/2009, 97 § osaksi laeissa 973/2007 ja 432/2009, 97 a § laissa 749/2011, 101 ja 102 § osaksi laissa 973/2007, 105 § laissa 973/2007, 147 a § laissa 1214/2013 sekä 201 § osaksi laeissa 432/2009 ja 195/2011, sekä
lisätään lakiin uusi 96 a, 99 a ja 198 b § seuraavasti:


Esityksen pääasiallinen sisältö
Lainaus
Esityksessä ehdotetaan muutettavaksi ulkomaalaislakia. Esityksellä pantaisiin täytäntöön uudelleen laadittu Euroopan parlamentin ja neuvoston direktiivi kansainvälisen suojelun myöntämistä tai poistamista koskevista yhteisistä menettelyistä. Samalla ulkomaalaislakia tarkistettaisiin siten, että se on yhdenmukainen kolmannen maan kansalaisen tai kansalaisuudettoman henkilön johonkin jäsenvaltioon jättämän kansainvälistä suojelua koskevan hakemuksen käsittelystä vastuussa olevan jäsenvaltion määrittämisperusteiden ja -menettelyjen vahvistamisesta annetun Euroopan parlamentin ja neuvoston asetuksen kanssa.

Uudelleen laaditun direktiivin tavoitteena on varmistaa jäsenvaltioiden entistä yhdenmukaisemmat menettelyt kansainvälisen suojelun myöntämisessä ja poistamisessa. Ulkomaalaislain säännökset vastaavat pitkälti direktiivissä säädettyä, mutta lakia on tarpeen täsmentää direktiivissä edellytetyllä tavalla. Merkittävimmät ehdotetuista muutoksista liittyvät hakijan kuulemiseen, haavoittuvassa asemassa oleviin hakijoihin, turvallisiin maihin, uusintahakemuksiin sekä täytäntöönpanon kieltämistä koskevaan hakemukseen.

Laki on tarkoitettu tulemaan voimaan 1 päivänä heinäkuuta 2015.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ArtturiE - 06.11.2014, 13:57:06
Mitä tuo direktiivi edellyttää? Lakia täsmennetään? Ei sano minulle mitään, mutta pelkään että tuo liittyy siihen vastuunjakoon, mistä on viime aikoina puhuttu nyt kun esim. Italia haluaa päästä eroon rannoilleen päätyvistä ja merestä ongituista onnenonkijoista.  Toivottavasti olen väärässä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.11.2014, 11:05:50
Tampereella järjestettiin viikolla kaksipäiväinen seminaari EU:n oikeus- ja sisäasioista. Paikalla muun muassa komissaari Cecilia Malmström, oikeusministeri Anna-Maja Henriksson ja twiiteistä päätellen myös pakolaisjärjestöjen edustajia:

https://twitter.com/hashtag/tampere15?f=realtime&src=hash

Lainaus
Eurooppatiedotus ‏@UM_ET Nov 4

Mikko Puumalainen ihmettelee miksi yhä puhutaan taakanjaosta, kuten 15 v sitten, vaikka yhteistä turvapaikkapolitiikkaa on luotu.#tampere15

Lainaus
Paivi Helander ‏@PHHelander Nov 4

Suomen kannettava osuutensa pakolaisten vastaanottamisessa, sanoo #oikeusministeri Henriksson #Tampere15

Lainaus
EU-komissio Suomessa ‏@EUkomissio Nov 4

@MalmstromEU ”We have to have a common asylum system in the EU. And it will lead to better and quicker #asylum systems” #tampere15

Lainaus
EU-komissio Suomessa ‏@EUkomissio Nov 4

Luigi Mattiolo: Citizens need to be reassured of the benefits of the integration. EU is part of the solution not the problem
#tampere15

Lainaus
Suvi Rasimus ‏@Rasisuv Nov 4

Cecilia Malmström kertoi, että tulee löytää keinoja ihmisten lailliselle tulolle EU:hun. @anna_maja @MalmstromEU @EUkomissio #Tampere15

Lainaus
Simo Kohonen ‏@Kohonsi Nov 4

@MalmstromEU #Resettlement easiest way to relief the #refugee situation. But only half of #EU MS resettling refugees. #migration #tampere15

Lainaus
Kaisa Väkiparta ‏@Kaisa_v Nov 4

25 million people will leave the labor market in EU in the next 20 years - why does #EU still restrict #migration? #tampere15

Lainaus
Nina Hotti ‏@nipsu_h Nov 4

Crabit: free movement of people is a right that cannot be limited. #Tampere15

Lainaus
Paivi Helander ‏@PHHelander Nov 4

#oikeusministeri Henriksson: yhteiskunnat kuten Ruotsi, jonne muuttajat ovat saaneet asettua, ovat usein luovempia.menestyvämpiä. #Tampere15

Lainaus
Jan Westö ‏@JREWest Nov 4

Great question from the audience: how to change the opinion of gen public on immigration to more positive, open?
#tampere15

Lainaus
EU-komissio Suomessa ‏@EUkomissio Nov 4

@anna_maja says that Finland cannot handle the economic challenges in the future without migration. #tampere15
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: DuPont - 10.11.2014, 03:54:13
Jotenkin surullisia tuo twiitit. Niin viimevuosikymmentä, tai jopa 1990-lukua. Ihan kuin mitään ei olisi opittu. No, ilmeisesti ei olekaan opittu. Aate määrää, ajatus ei.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope2 - 10.11.2014, 08:12:51
Suvi Rasimus ‏@Rasisuv Nov 4

Cecilia Malmström kertoi, että tulee löytää keinoja ihmisten lailliselle tulolle EU:hun. @anna_maja @MalmstromEU @EUkomissio #Tampere15




Nyt on kyllä joku aivan pihalla ! Ainakin Schengen-maiden lähetystöistä löytyy lomakkeita, joita täyttämällä ja tarvittavia lisäasiakirjoja mukaan liittämällä, mahdollisesti pidetyn haastattelun jälkeen, suuri määrä ihmisiä on saanut oikeuden laillisesti saapua Schengen-alueelle ja viipyä siellä tietty ajanjakso.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kulttuurirealisti - 11.11.2014, 14:50:15
Lainaus
Kaisa Väkiparta:
25 million people will leave the labor market in EU in the next 20 years - why does #EU still restrict #migration?

Työvoimapula uhkaa taas. Mitä jos vähän kuitenkin toppuuteltaisiin, kyllä siinä 2025 jälkeen ehtii taas tarkistaa paljonko tarvitaan luku- ja kielirajoitteisia työvoimapulan paikkaajia.

Lainaus
EU-komissio Suomessa:
@anna_maja says that Finland cannot handle the economic challenges in the future without migration.

Eikä Suomi toisaalta pysty handlaamaan tulevia maahanmuuton aiheuttamia "talouden haasteita".
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ArtturiE - 17.11.2014, 00:25:54
Nuo pitkän tähtäyksen suunnitelmat ontuvat jo lähtökohtaisesti. Jos kerran tiedetään (muka) työvoimapulan tulosta, miksi ei sitten ajoissa kouluteta reservissä olijoita tulevaa tilannetta varten?  Eihän se työvoimapula tule yhdessä yössä, jos ollenkaan.  Mitä siihen pulaan auttaa kouluttamaton, kielitaidoton, motivoitumaton, huonosti uuteen asuinmaahansa integroituva tuontireservi?
Jos osa sopeutuukin niin kustannukset ovat kaksin-kolminkertaiset maassa olevaan kantaväestöön verrattuna.  Lisäarvona ei voida pitää monikulttuurisuutta, koska sekin maksaa moninkertaisesti yhteiskunnalle tukipalveluiden ja kaiken muun räätälöidyn toiminnan järjestämisen takia.  Voittajia ovat vain julkisen sektorin työntekijät, joiden määrää joudutaan kasvattamaan.  Häviäjiä ovat suomalaiset veronmaksajat ja työntekijät.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.11.2014, 12:08:13
Lainaus
UNHCR:n Euroopan johtaja Vincent Cochetel tutustui torstaina Migrationsverketin toimintaan muun muassa Märstassa. Hän korosti ruotsalaisen pakolaisten vastanoton laatua sekä solidaarisuuden puutetta EU:n 28 jäsenmaan enemmistöltä.

– On epänormaalia, että kaksi maata ottaa niin suuren vastuun. Se ei tarkoita, että Ruotsin ja Saksan pitäisi muuttaa vastaanottoaan, vaan että muiden jäsenmaiden pitäisi osoittaa samaa sitoutumista.

[...]

Miksi muiden EU-maiden pitäisi ottaa suurempi vastuu pakolaisten vastaanotosta?

– Saksa on ottanut esille kysymyksen kiintiöistä. On tärkeää, että Cecilia Malmströmin seuraaja Dimitris Avramopoulos pakolaisasioista vastaavana komissaarina selvittää, millä kriteereillä kiintiöinti tapahtuisi.

Kun olemassa on jo säännöt, Dublin-sopimus, joka määrittelee, millä maalla on vastuu turvapaikkahakemuksen tutkimisesta, ei nykyistä pakolaisten vastaanoton epätasapainoa pitäisi olla, sanoo Vincent Cochetel.

– Tietyt maat eivät noudata lainsäädäntöä ja normaalisti niihin pitäisi kohdistaa taloudellisia sanktioita. Valitettavasti näin ei tehdä turvapaikka-asioissa, mutta se on työkalu, jota komissio voisi käyttää painostuskeinona.

Vincent Cochetelia huolestuttaa, että Eurooppaan pääsee laillisesti vain harvoja reittejä, joten pakolaiset kohtaavat rajoilla piikkilankaesteet Bulgariasta idässä Espanjan enklaaveihin Ceutaan ja Melillaan lännessä.

– Eurooppa on piikkilangoitettu, joten pakolaiset pakenevat ainoan avoimen rajan yli, joka on Välimeri.

UNHCR tutkii useita ratkaisuja, jotka loisivat Eurooppaan enemmän laillisia väyliä ja siten vähentäisivät riskiä kuolla huonokuntoisissa paateissa Välimerellä tai päätyä kyynisen salakuljetusteollisuuden kynsiin.

Ehdotuksiin kuuluu pakolaisviisumit opiskelijoille ja rahastot, joiden kautta pakolaiset voisivat lainata rahaa matkojen järjestämiseen. Yksi ehdotus on antaa vapaaehtoisjärjestöjen sponsoroida matkoja ja ottaa vastuu pakolaisten perustarpeiden järjestämisessä, kuten auttaa asunnon saamisessa, kun he saapuvat EU:hun.

Onko syytä uskoa, että tällainen estäisi ihmisiä hakeutumasta Eurooppaan Välimeren yli?

– Jos on laillisia väyliä saapua Eurooppaan, niin kyllä. Uskon, että ihmiset miettisivät pariin kertaan ennen kuin ottaisivat riskin kuolla Välimerellä tai päätyä pitkäkestoiseen eristykseen. Mutta niin kauan kuin laillisia väyliä ei ole, tulevat pakolaiset ottamaan riskejä.   (käännös)
Svenska Dagbladet: ”Onormalt att två länder tar så stort ansvar” (http://www.svd.se/nyheter/inrikes/onormalt-att-tva-lander-tar-sa-stort-ansvar_4142965.svd) 27.11.2014

UNHCR:lle tiedoksi, että laillisia väyliä Eurooppaan ja EU:hun ovat muun muassa lukuisat raja-asemat Kreikassa, Bulgariassa, Puolassa, Virossa ja Suomessa. Syystä ja toisesta raja kuitenkin ylitetään mieluiten juuri sieltä, mistä sitä ei saisi ylittää.

Ihmettelen myös Cochetelin käsitystä, että Dublin-sopimus jotenkin tasaisi turvapaikanhakijamäärät Euroopassa, jos sitä vain noudatettaisiin. Suurin osa EU:n turvapaikanhakijoista on saapunut turvapaikanhakumaahan jonkin toisen EU-maan kautta. Lähes kaikki Suomenkin turvapaikanhakijat saapuvat tänne Ruotsista. Dublin-sopimuksen piti alunperin lopettaa tällainen turvapaikkashoppailu, mutta sopimukseen on tarkoituksella liitetty yhä enemmän perusajatuksen vesittäviä poikkeuksia, jotka estävät sen kunnollisen soveltamisen. Malmströmin ja kumppanien vähemmän peitelty tavoite onkin ollut vähä vähältä tuhota Dublin-sopimus, jotta päästään sorvaamaan jäsenmaille EU:n määräämiä pakolaiskiintiöitä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kemolitor - 01.12.2014, 20:16:49
Tampereella järjestettiin viikolla kaksipäiväinen seminaari EU:n oikeus- ja sisäasioista. Paikalla muun muassa komissaari Cecilia Malmström, oikeusministeri Anna-Maja Henriksson ja twiiteistä päätellen myös pakolaisjärjestöjen edustajia:

https://twitter.com/hashtag/tampere15?f=realtime&src=hash

Monitori-lehti raportoi samasta seminaarista:

Lainaus
Tampereella puitiin EU:n yhteistyötä oikeus- ja sisäasioissa

 Suomen ensimmäisen EU-puheenjohtajuuskauden huippukokouksessa Tampereella vuonna 1999 asetettiin tavoitteeksi vapauden, turvallisuuden ja oikeuden alueen muodostaminen. Samalla luotiin perustukset Euroopan yhtenäiselle turvapaikkapolitiikalle. Missä mennään nyt, 15 vuotta myöhemmin? Tilannetta analysoitiin Euroopan komission Suomen edustuston järjestämässä Tampereen ohjelman juhlaseminaarissa marraskuussa.

Viisitoista vuotta sitten laadittu niin sanottu Tampereen ohjelma oli ensimmäinen EU:n hyväksymä viiden vuoden ohjelma, joka koskee EU:n oikeus- ja sisäasioiden yhteistyön kehittämistä (Justice and Home Affaris JHA). Tampereen ohjelmaa jatkoivat Haagin ohjelma vuosina 2005 - 2009 ja Tukholman ohjelma vuosina 2010 - 2014.

Marraskuussa Tampereella järjestetyssä juhlaseminaarissa puhunut oikeusministeri Anna-Maja Henriksson kertoi, että kuluvan vuoden kesäkuussa EU:n valtionpäämiehet hyväksyivät uudet strategiset linjaukset, jotka ohjaavat työtä oikeus- ja sisäasioiden alalla tulevina vuosina.

”Uusissa linjauksissa korostetaan, että kaikkien jäsenvaltioiden tulee panna tehokkaasti täytäntöön se valtava määrä lainsäädäntöä, joka EU:ssa on viime vuosina hyväksytty. Nyt meidän on keskityttävä viimeistelemään se, mikä Tampereella aloitettiin”, hän sanoi.

”Nykyisenä taloudellisesti niukkana aikana on varottava ottamasta taka-askelia yhteisten arvojemme toteuttamisessa. Jos haluamme pitää niistä kiinni, emme voi jäädä passiivisiksi, kun suvaitsemattomuus ja muukalaisviha nostavat päätään.”

EU:n nykyinen kauppakomissaari, entinen EU:n sisäasioista vastaava komissaari Cecilia Malmström painotti Tampereella, että nykyinen maailmantilanne on luonut ongelmia, joita jäsenmaat eivät yksinkertaisesti kykene ratkaisemaan yksin. Näillä ongelmilla hän viittasi muun muassa korruptioon, järjestäytyneeseen rikollisuuteen ja terrorismiin.
-----
”Olemme kulkeneet jo todella pitkän matkan ja saaneet paljon aikaan muun muassa yhteisen turvapaikkapolitiikan saralla”, hän sanoo ja painottaa, että asioita tapahtuu koko ajan myös käytännön tasolla.
-----
 Tilaisuudessa kuultiin myös Italian ulkoasiainministeriön EU-asioista vastaavaa johtajaa Luigi Mattioloa. Italia aloitti EU-puheenjohtajamaana 1. heinäkuuta 2014 ja hoitaa puheenjohtajuutta vuoden loppuun saakka. Mattiolo kertoi puheenjohtajuuskauden prioriteeteista ja haasteista.

”Siirtolaisvirtojen kasvaminen ja muuttuminen liittyy tiiviisti Euroopan unionin rajoilla tapahtuviin kriiseihin ja vaatii vahvaa poliittista vastausta EU-tasolta. Siksi maahanmuutto- ja pakolaisasiat ovat Italian puheenjohtajuuskauden prioriteettien kärjessä”, Mattiolo painotti.

Hän kertoi, että Italian tavoitteena on edistää laillista maahanmuuttoa ja siten vahvistaa kehitystä ja talouskasvua sekä lähtömaissa että vastaanottavissa maissa. Samalla pyritään tarjoamaan kansainvälistä suojelua sitä tarvitseville sekä ehkäisemään laitonta maahanmuuttoa. Italian mukaan nyt on erityisen tärkeää taistella ihmiskauppaa ja -salakuljetusta vastaan.

”Yhteistyöllä kolmansien maiden kanssa on tärkeä rooli laittoman maahanmuuton ehkäisyssä”, hän sanoi ja kertoi Italian lanseeraavan nyt pitkäkestoisen dialogin eli niin kutsutun Khartumin prosessin Itä-Afrikan siirtolaisreitin varrella sijaitsevien maiden kanssa.
Italia painottaa rajavalvonnan merkitystä

Mattiolon puheessa korostui myös rajavalvonnan tehostaminen EU:n ulkorajoilla.

”Vahvempi ja tehokkaampi rajavalvonta on perusta kokonaisvaltaiselle maahanmuuttopolitiikalle.”

Hän kertoi, että Lampedusan tragedian jälkeen Italian toteuttama Mare Nostrum -pelastusoperaatio Välimerellä saavutti merkittäviä tuloksia: operaation aikana pidätettiin yli 500 ihmisten salakuljettajaa ja pelastettiin yli 90 000 maahan pyrkivän ihmisen henki.

Mare Nostrum on tänä syksynä tullut tiensä päähän ja Italia aloitti sen vaiheittaisen alasajon 1.11.2014. Samaan aikaan käynnistyi Frontexin uusi, Italiaa tukeva Triton-operaatio, joka on kuitenkin huomattavasti Mare Nostrumia pienempi ja painottuu pelastustehtävien sijasta valvontaan.

TRITON-operaatioon osallistuu isäntämaa Italian lisäksi 18 jäsenvaltiota. Myös Suomi on mukana ja lähettää operaatioon Dornier-merivalvontalentokoneen ja henkilöstöä. TRITON-operaatio toimii lähempänä Italian rannikkoa kuin Mare Nostrum.

Koko juttu:
Monitori: Tampereella puitiin EU:n yhteistyötä oikeus- ja sisäasioissa (http://www.intermin.fi/fi/ajankohtaista/monitori-lehti/1/0/tampereella_puitiin_eu_n_yhteistyota_oikeus-_ja_sisaasioissa_57009?language=fi)

En oikein ymmärtänyt Mattiolon ajatusta siitä, miten laillinen maahanmuutto vahvistaisi talouskasvua ja kehitystä lähtömaissa. Jos hän tarkoittaa, että ne jotka nyt tulevat laittomasti Eurooppaan pääsisivätkin tänne laillisesti ja kun kyseessä ovat ennen kaikkea parhaassa työiässä olevat nuoret miehet, niin miten tällainen toiminta edistäisi kehitystä ja talouskasvua lähtömaissa.

No, ehkä hän juuri siksi on Italian ulkoasiainministeriön EU-asioista vastaavaa johtaja, kun kykenee ymmärtämään noin monimutkaisia asioita.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 08.12.2014, 15:37:11
Lainaus
Tällä viikolla: Budjettineuvottelut, maahanmuutto, ehdokkaat yhteiseen kriisinratkaisuneuvostoon

...
Kansalaisvapauksien valiokunnassa äänestetään torstaina päätöslauselmasta, joka käsittelee maahanmuuttotilannetta Välimerellä ja vastuiden tasapuolisempaan jakoon jäsenmaiden välillä. Pelastus- ja etsintäoperaatiot, yhteistyö kolmansien maiden kanssa ja ihmiskauppa ovat kaikki aiheita, jotka mainitaan tekstissä.
...

Euroopan parlamentti (http://www.europarl.europa.eu/news/fi/news-room/content/20141205STO82906/html/T%C3%A4ll%C3%A4-viikolla-Budjetti-maahanmuutto-yhteinen-kriisinratkaisuneuvosto)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 18.12.2014, 21:16:12
Lainaus
Turvapaikka myönnetään henkilöille, jotka pakenevat vainoa tai vakavaa vahinkoa. Turvapaikan saaminen on perusoikeus ja sen myöntäminen on vuonna 1951 tehdyn pakolaisten oikeusasemaa koskevan Geneven yleissopimuksen mukainen kansainvälinen velvoite. EU on alue, jonka rajat ovat avoimet ja jolla liikkuvuus on vapaata. Tarvitsemme siis yhteisen lähestymistavan turvapaikka-asioihin. Turvapaikanhakijoiden virrat eivät ole jatkuvia eivätkä ne jakaudu tasaisesti eri puolille EU:ta. Esimerkiksi vuonna 2001 nykyiset EU-maat (EU-27) vastaanottivat 425 000 turvapaikkahakemusta, mutta vuonna 2006 vain alle 200 000. Vuonna 2012 hakemuksia oli yli 330 000. Turvapaikan hakeminen ei saa olla arpapeliä. EU:n jäsenvaltioilla on yhteinen vastuu ottaa turvapaikanhakijat vastaan ihmisarvoisella tavalla. Niiden on varmistettava, että hakijoita kohdellaan oikeudenmukaisesti ja että heidän tapauksensa tutkitaan yhdenmukaisia normeja noudattaen, jotta tulos on aina samanlainen riippumatta siitä, missä hakemus on tehty.
Euroopan yhteinen turvapaikkajärjestelmä (http://bookshop.europa.eu/fi/euroopan-yhteinen-turvapaikkajaerjestelmae-pbDR0413088/;pgid=Iq1Ekni0.1lSR0OOK4MycO9B0000moeRIh5Q;sid=GHiRw0jHF1SRgxxUOioPZCriVRuPseoEZCg=?CatalogCategoryID=BT6ep2IxkioAAAEq59tg2UKH) (pdf, 8 sivua)

Tuollaisesta ei onneksi ole vielä sovittu, vaikka Cecilia Malmström on sellaista ajanut. Jäsenmailla ei ole aikomustakaan yhdenmukaistaa turvapaikkakäytäntöjään ja -kriteerejään samanlaisiksi. Kaikki maat pitävät kiinni omista linjauksistaan.

Lainaus
Suojelun ja solidaarisuuden alue heikoimmassa asemassa oleville

Euroopan yhteinen turvapaikkajärjestelmä on ollut tärkeimpiä prioriteettejani koko toimikaudellani, ja olen ollut mukana sitä koskevissa neuvotteluissa alusta alkaen. Järjestelmän käyttöönotto on historiallinen saavutus, johon EU:n jäsenvaltiot ja parlamentti ovat pyrkineet vuodesta 1999.

Euroopan yhteisen turvapaikkajärjestelmän avulla suojelua hakevat henkilöt pääsevät aiempaa paremmin turvapaikkamenettelyn piiriin ja turvapaikkapäätökset ovat oikeudenmukaisempia, nopeampia ja parempia. Sen kautta varmistetaan, ettei vainoa pakenevia henkilöitä palauteta takaisin vaaratilanteeseen ja että turvapaikkaa hakeville ja kansainvälistä suojelua saaville henkilöille taataan asianmukaiset ja ihmisarvoiset olosuhteet EU:ssa.

Matka on ollut kuoppainen, eikä kaikki ole vieläkään valmista. Nyt on tehtävä lujasti työtä lainsäädännön panemiseksi täytäntöön ja sen varmistamiseksi, että yhteinen järjestelmä toimii hyvin ja yhdenmukaisesti. Vasta sen jälkeen suojelun ja solidaarisuuden alue ansaitsee nimensä, ja voimme olla saavutuksestamme ylpeitä.

Cecilia Malmström,
sisäasioista vastaava komissaari
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 18.12.2014, 21:20:11
Jos sosiaalituristeille maksettavat etuudet olisivat yhtenäisiä esim. Kreikan tai Viron kanssa olisi ongelma paljon pienempi. Jos meillä tämän lisäksi olisi valppaita virkamiehiä, vaikkapa sellaisia holiiseja, puuttumassa myös vähäisempiin rikoksiin niin ongelma pienenisi edelleen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.12.2014, 18:38:12
Maahanmuuttoasioita EU-parlamentissa käsittelevän kansalaisvapausvaliokunnan puheenjohtajan haastattelu:
Lainaus
Meppi Claude Moraes vastaa asiantuntijoiden kysymyksiin päätöslauselmastaan, joka koskee yhdistettyä lähestymistapaa turvapaikkoihin ja maahanmuuttoon liittyvien lukemattomien ongelmien ratkaisemiseen.
Muuttoliike: nyt on aika toimia (http://europarltv.europa.eu/fi/player.aspx?pid=57d43e02-72aa-4b58-8443-a406009d32a7) (video, 5 min)

Lainaus käyttäjältä: Claude Moraes
Meidän on tehtävä vaikeita päätöksiä muuttoliikkeestä. Lisää laillisia reittejä tarkoittaa, että jäsenmaiden on todella herättävä siihen, mitä se tarkoittaa. Sitä, että tarvitsemme hallitun muuttoliikkeen politiikan. Se tarkoittaa, että jos EU huolimatta säästötoimista... Meidän on ymmärrettävä ja myönnettävä, että tarvitsemme muuttoliikettä. Kuka tekee kaikki matalapalkkaiset työt EU:ssa? (..) On myönnettävä, että muuttoliikettä tarvitaan ja sitä on. EU:ssa on yhä ikääntyvä väestö, matalapalkkamuuttoliikettä, ammattitaitoista muuttoliikettä EU:n ulkopuolelta.

Lainaus käyttäjältä: Claude Moraes
Muuttoliikkeeseen liittyy kuluja Länsi-Euroopan maissa, ja se tulee esiin tässä. Mutta kuluista on myös hyötyjä. Muuttoliike tuo myös taloudellista hyötyä. Tiedämme sen, on todistettu, että siitä on taloudellista hyötyä.

Lainaus käyttäjältä: Claude Moraes
EU:n politiikka Syyrian kaltaisissa kysymyksissä on asuttamispolitiikka (resettlement = kiintiöpakolaisten vastaanotto). Muut politiikat Syyrian kaltaisissa ongelmissa ovat jäsenmaiden asia. Asuttamisohjelma ei toimi hyvin. Asuttaminen on hyvin epäsuhtaista. Jotkut maat eivät ota juuri yhtään Syyrian pakolaista ja jotkut ottavat monia. Eli taakkaa ei jaeta, minkä vuoksi päätöslauselmamme viittaa holistiseen lähestymistapaan. Taakan jakamista pitää parantaa. Neuvoston ja jäsenvaltioiden on tehtävä työnsä. Komissio pyytää sitä, EU-parlamentti pyytää sitä, mutta jäsenmaat eivät tee työtään. Ne eivät jaa taakkaa. (..) Sitä [Dublinin sopimusta] ei tarvitse muuttaa paljon. Dublinin yleissopimus on olemassa, sitä voidaan uudistaa. Meillä on direktiivi vastaanotto-olosuhteista, meillä on Euroopan yhteinen turvapaikkajärjestelmä. Se kaikki on kunnossa. Ongelmana on toimeenpano. Niitä ei toimeenpanna jäsenvaltioissa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.12.2014, 19:37:43
EU:n uusi maahanmuuttokomissaari Dimitris Avramopoulos puuhaa jo täyttä päätä yhdessä Saksan sisäministeri Thomas de Maizièren kanssa jäsenmaille turvapaikanhakijakiintiöitä. "Vapaaehtoisilla" kiintiöillä on toistaiseksi vasta kymmenen jäsenmaan tuki (mm. Saksa, Ruotsi, Ranska ja Itävalta), mutta sisäministeri de Maizière lupaa painostaa muita jäsenmaita, kunnes nekin lähtevät mukaan "taakanjakoon".

Jotta eurooppalaisten elämä muuttuisi entistäkin mielenkiintoisemmaksi, EU-suunnitelmiin kuuluvat myös Afrikkaan perustettavat turvapaikanhakukeskukset, joista käsin voi hakea turvapaikkaa etänä saapumatta ensin Eurooppaan. Saksan sisäministerin mukaan keskukset takaisivat nyt laittomuuksiin turvautuville pakolaisille laillisen ja turvallisen pääsyn Eurooppaan. Edellinen maahanmuuttokomissaari Cecilia Malmström arvioi (http://hommaforum.org/index.php/topic,94467.msg1651504.html#msg1651504), että pelkästään Libyan Bengasiin perustettavan toimiston ovella olisi päivässä 200 000 ihmistä.

Lainaus
Avramopoulos proposes new strategies to solve refugee crisis

Migration Commissioner Dimitris Avramopoulos called for more solidarity between EU member states in accepting refugees, announcing reforms in his first meeting with German Internal Affairs Minister Thomas de Maizière.

Despite the introduction of the Common European Asylum System (CEAS) at the start of this year, EU member states still do not have common standards with regard to refugee policy. Conditions in refugee camps in southern Europe are still disastrous, and Italy allows refugees to travel on through its northern borders without applying for asylum.

But Dimitris Avramopoulos, the EU’s new Commissioner for Migration, Home Affairs, and Citizenship, hopes to put an end to these issues.

“The Commission is determined to adopt a more enhanced and cohesive asylum policy than ever before,” the Greek politician said on Tuesday at the end of his meeting with Germany’s Internal Affairs Minister Thomas de Maizière, in Berlin.

All member states – even states at the EU’s external borders – must “fulfill their legal obligations”, the Commissioner emphasised. “Responsibility and solidarity go hand in hand.”

[...]

Avramopoulos and de Maizière both hope to reach a fairer distribution of refugees in the future. On Tuesday, they agreed that a quota system would be the best way to achieve this.

“To maintain the Dublin III system, we need a distribution system that also takes into account additional burdens on certain member states,” said de Maizière.

The call for a more just distribution is part of a package of measures agreed in October by EU countries, on the basis of which the Commission hopes to submit a legislative proposal.

The proposal is planned to include a concrete method and relevant criteria for a quota system, Avramopoulos explained.

[...]

Another aspect of the Commission’s proposal is likely to be a bid for refugee “welcome centres” in North African transit countries. Refugees seeking protection in Europe would be able to register in the centres without crossing EU borders. Then UNHCR and EU authorities would be able to decide whether or not to allow entry into Europe.

“Isn’t it more humane to create welcome centres, particularly in transit countries, instead of watching [refugees] drown in the Mediterranean Sea? With these centres, we will create a possibility to travel to Europe legally and put a stop to trafficking,” de Maizière explained.
EurActiv (http://www.euractiv.com/sections/justice-home-affairs/avramopoulos-proposes-new-strategies-solve-refugee-crisis-310525) 2.12.2014

Lainaus
Berlin and European Commission to cooperate more closely on refugees

Avramopoulos is also maintaining contact with representatives of both the countries of origin and transit countries, a point he stressed in Rome last week at a meeting of interior ministers, which was also attended by ministers from several African countries. The meeting served to launch the Khartoum process ­­– a dialog with the East African countries from which many refugees originate or that serve as transit routes for asylum seekers en route to Europe. Those that oversee the reception centers in the transit countries are also part of the dialog.

De Maizière said that these centers could be equipped to process legal entry into the EU, thus stripping criminal traffickers of their source of income.
Deutsche Welle (http://www.dw.de/berlin-and-european-commission-to-cooperate-more-closely-on-refugees/a-18107021) 3.12.2014

Deutsche Welle: Terror, Refugees & Asylum - A Challenge for Europe (http://www.dw.de/terror-refugees-asylum-a-challenge-for-europe/a-18102244) (Saksan sisäministeri Thomas de Maizieren englanniksi dubattu haastattelu, 12 min) 30.11.2014
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 20.01.2015, 13:49:12
Maahanmuuttokomissaari Dimitris Avramopoulos ryhtyy hieromaan jäsenmaiden kanssa kiintiökriteerejä:

Lainaus
"So Europe needs to do more. We have to increase the number of refugees resettled in EU countries.

In order to ensure that Member States share this responsibility, the Commission has set up a resettlement and relocation forum to develop, in cooperation with Member States, a fair distribution key."
Dimitris Avramopoulos, Commissioner for Migration: Speech - Recent human smuggling incidents in the Mediterranean (http://europa.eu/rapid/press-release_SPEECH-15-3262_en.htm) 13.1.2015

Lainaus
Defying the populist agenda?

Might a centre-right Greek politician, formerly in charge of defence policy, be able to reach a compromise among EU member states on immigration reform?

[...]

The announcement that the Commission is working on a ‘distribution key’ for refugees based on criteria such as member states’ population and GDP per capita shows a commitment to try to break the EU governments’ stalemate on the Common European Asylum System.

"Europe has to take charge" said Avramopoulos, almost echoing the repeated requests for help by Italian Prime Minister Matteo Renzi.

The Commission and member states need to move beyond the mantra of implementing the EU's current asylum system and start innovating on how to improve it.

For example, the Dublin regulation provides that asylum seekers need to remain in the first EU country of entry, a position that most member states have continued holding despite the fact that in 2014 around 200,000 potential asylum seekers landed in Italy alone.

If member states could agree on a distribution key for refugees, the EU would avoid the paradoxical situation of having two thirds of its refugee population and asylum claims concentrated on only five of its member states.

After solidarity among member states and redistribution of asylum seekers, access to protection is the other big challenge that the EU needs to face.

[...]

Avramopoulos’ final remarks to the Parliament showed that he is well aware that he will face strong opposition as soon as he tries to tackle Commission President Juncker’s five-point plan on immigration, which provides also for an integrated policy on legal (i.e. labour) migration – an area so far almost exclusively in the hands of the member states.

But the cautious approach he presented on the idea of the distribution key for asylum– “avoiding negotiation and agreeing on a minimum set of common criteria in order to experiment” – may well open some doors that will lead to a greater appetite for the innovative and solution-based immigration reform that is urgently needed.

Costanza Hermanin is a migration policy experts at the Open Society European Policy Institute
EUobserver (https://euobserver.com/opinion/127248) 19.1.2015

Maahanmuuttokomissaari haluaa lisätä kiintiöpakolaisten vastaanottoa EU-maihin ja helpottaa turvapaikanhakijoiden pääsyä EU-alueelle, mutta ensin on saatava pystyyn järjestelmä, joka tasaa pakolaispolitiikan kustannukset ja ohjaa tulijat "reilummin" eri maiden kesken. Tähän tarvitaan nyt neuvoteltava "fair distribution key" eli "reilut" pakolaiskiintiökriteerit, joiden perusteella jäsenmaat saavat ensin tukieuroja ja joiden mukaan ryhdytään myöhemmin siirtämään turvapaikanhakijoita "kuormittuneista" jäsenmaista vähemmän kuormittuneisiin (http://www.hs.fi/kotimaa/a1421301619983). Suomessa poliitikot eivät ole tietääkseenkään jo pitkään valmistellusta hankkeesta.

Suomi tulee maksamaan tämän lystin EU-rahaston kautta rahana muille jäsenmaille (esim. Ruotsi) ja/tai ottaa vastaan nykyiseen verrattuna moninkertaisen ("reilun") määrän turvapaikanhakijoita, mikä tulisi vieläkin kalliimmaksi sekä taloudellisesti että yhteiskunnallisina haittavaikutuksina. Samaan aikaan komissio ja europarlamentti tekevät hartiavoimin töitä, että Eurooppaan saataisiin entistä enemmän kiintiöpakolaisia, turvapaikanhakijoita ja laittomia siirtolaisia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 20.01.2015, 13:57:30
Lainaus
based on criteria such as member states’ population and GDP per capita

Ilmeisesti siis 'pakolaiset' ja heidän jälkeläisensä saa palauttaa, jos maan bruttokansantuote laskee.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 20.01.2015, 14:38:14
En nyt viitsi selvittää viime vuosien suhteellisia BKT-muutoksia, mutta vuoden 2008 arvoilla (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770) ja viime vuoden turvapaikanhakijamäärällä Suomen "reilu" osuus EU-alueelle tulleista turvapaikanhakijoista olisi aiemmin esitetyillä kriteereillä (väkiluku, pinta-ala ja BKT yhtä suurella painolla) noin 25 000 turvapaikanhakijaa. Tuo on tänä vuonna käynnistyvien komission ja jäsenmaiden välisten neuvottelujen lähtökohta. Suomen osuus voi kasvaa tuostakin sekä prosenttiosuuden kasvun (kriteerien toisenlainen painotus, väestötiheysleikkuri) että muualle Eurooppaan pyrkivien turvapaikanhakijoiden määrän kasvun kautta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 20.01.2015, 19:20:08
Taakanjako ja yhteinen pakolaispolitiikka etenee normaalisti niin kuin mitään ei olisi tapahtunut ja miksipä ei etenisi. Eihän turvapaikanhakijoilla tai pakolaisilla ollut mitään tekemistä Pariisin terrori-iskujen kanssa, sillä tekijät olivat ranskalaisia. Aivan kuten Saksassa ja Belgiassa tehdyissä operaatioissa pidätetyt ovat olleet belgialaisia ja saksalaisia.

Tästä asiasta on pakko saada vaaliteema. Suomi ei kestä sitä, että maahan muuttaa vuosittain 25 000 uutta asukasta, joilla ei ole mitään koulutusta ja joiden työllistymismahdollisuudet ovat muutenkin heikot. Ei kestäisi siltikään, vaikka osa tulijoista joutuisi lähtemään kielteisen oleskelulupapäätöksen saatuaan pois. Varsinaiseen turvapaikkaan on varmaan edellytyksiä hyvin harvalla. Toisaalta olisiko sillä mitään merkitystä, jos CEAS olisi vaaliteema. Brysselin keskuskomitea sen päättää, mikä on Suomen kannalta "reilua". Ei sitä suomalaisilta kysytä niin kuin ei ole kysytty mitään muutakaan enää pitkään aikaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 20.01.2015, 21:22:22
Suomi ei kestä sitä, että maahan muuttaa vuosittain 25 000 uutta asukasta, joilla ei ole mitään koulutusta ja joiden työllistymismahdollisuudet ovat muutenkin heikot. Ei kestäisi siltikään, vaikka osa tulijoista joutuisi lähtemään kielteisen oleskelulupapäätöksen saatuaan pois.

Lainaus
Cecilia Wikström (ALDE, SE), speaking on behalf of the ALDE group, said that the core problem is that there is no way for desperate migrants to get to the EU. As a consequences, they have to entrust themselves to “scrupulous” human traffickers – which therefore have “a monopoly on the market.” In this context, she said, the solution is to break this monopoly and that this can be done by creating legal methods for desperate migrants to get to Europe – for example through humanitarian visas that are issued in the areas where these people want to flee from. She stressed that this would not be the same as opening the EU external borders for mass immigration because all migrants arriving in the EU would still need to undergo an asylum process, and that, naturally, if an asylum claim cannot be upheld, migrants must return to where they came from.
The Parliament Magazine: MEPs call to address increasing migratory pressures in the Mediterranean (https://www.theparliamentmagazine.eu/articles/eu-monitoring/meps-call-address-increasing-migratory-pressures-mediterranean) 14.1.2015

Eli europarlamentaarikko Wikströmin mukaan otetaan ensin muutama miljoona turvapaikanhakijaa Eurooppaan, tutkitaan heidän tapauksiaan parin vuoden ajan ja lopuksi perusteettomat hakijat palaavat kiltisti takaisin kotiinsa. Mikä voisi mennä pieleen?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 20.01.2015, 21:26:10
***
Eli europarlamentaarikko Wikströmin mukaan otetaan ensin muutama miljoona turvapaikanhakijaa Eurooppaan, tutkitaan heidän tapauksiaan parin vuoden ajan ja lopuksi perusteettomat hakijat palaavat kiltisti takaisin kotiinsa. Mikä voisi mennä pieleen?

Muutama miljoona suloista vauvaa ja raudanlujaa perhesidettä?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Vinyylihanska - 21.01.2015, 20:12:10
En nyt viitsi selvittää viime vuosien suhteellisia BKT-muutoksia, mutta vuoden 2008 arvoilla (http://hommaforum.org/index.php/topic,27433.msg580770.html#msg580770) ja viime vuoden turvapaikanhakijamäärällä Suomen "reilu" osuus EU-alueelle tulleista turvapaikanhakijoista olisi aiemmin esitetyillä kriteereillä (väkiluku, pinta-ala ja BKT yhtä suurella painolla) noin 25 000 turvapaikanhakijaa. Tuo on tänä vuonna käynnistyvien komission ja jäsenmaiden välisten neuvottelujen lähtökohta. Suomen osuus voi kasvaa tuostakin sekä prosenttiosuuden kasvun (kriteerien toisenlainen painotus, väestötiheysleikkuri) että muualle Eurooppaan pyrkivien turvapaikanhakijoiden määrän kasvun kautta.

Uskomatonta! Miksi suomenuutiset ei tee asiasta otsikoita? Tämä tulee maksamaan paljon verojen muodossa, eikä pelkästään meille jotka neekeri naapureista saamme nauttia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 21.01.2015, 20:33:36
Tämä tulee maksamaan paljon verojen muodossa, eikä pelkästään meille jotka neekeri naapureista saamme nauttia.

Ensimmäinen vaihe tuskin on turvapaikanhakijoiden siirtäminen maasta toiseen vaan se, että saamme maksaa pakolaisrahaston kautta muille maille siitä, että emme täytä laskennallista turvapaikanhakijakiintiötämme. Muutama vuosi sitten sakkomaksuksi kaavailtiin 8 800 euroa per turvapaikanhakija, joten 10 000 euroa lienee nyt käypä likiarvo. Se tarkoittaisi Suomelle nykytilanteessa reilun 200 miljoonan euron mätkyä, mutta toisaalta 25 000 turvapaikanhakijan kiintiön täyttäminen vasta kalliiksi kävisikin. Ruotsissa taas hihkuttaisiin yhä riemukkaammin, kuinka he tienaavat maahanmuutolla, kun saisivat EU:n kautta puolen miljardin euron pakolaiskorvaukset.

Kun tuo miljardien eurojen rahamylly ryhtyy jauhamaan, ei paluuta enää ole. Kaavaillut kiintiöt on pakko saada kaadettua.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: BeerBelly - 21.01.2015, 21:00:36
200 miljoonaa siitä ettei tarvitse ottaa vastaan 20 000 tupahaa, joista noin puolet saa turvapaikan tai oleskeluluvan ja perheet seuraa perästä? Pilkkahinta. Kouluttamaton kehitysmaalainen kustantaa elämänsä aikana helposti satoja tuhansia euroja Suomen kaltaisessa sosiaalivaltiossa. Onko tänne saapuvat tupahat mahdollista myydä eteenpäin maksamalla kymppitonnin myötäjäiset? Se olisi aivan käsittämättömän loistavaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Uuno Nuivanen - 21.01.2015, 21:12:21
Persupelkoinen hallitus ja media vaikenee asiasta kuin muuri.  :(
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 21.01.2015, 21:13:58
Lainaus
Saksa on vahvin maahanmuuton magneetti Euroopassa

"Kaikki EU-maat eivät tee osaansa turvapaikanhakijoiden vastaanottamisessa", sanoi Saksan sisäministeri.

[...]

Vuoden 2014 tiedetään jo nyt olleen ennätysmäinen turvapaikanhakijavuosi.

Saksan sisäministeri Thomas de Maizière antoi keskiviikon tiedotustilaisuudessa risuja niille EU-maille, jotka "eivät tee osaansa" turvapaikan hakijoiden suhteen.

"Tässä Saksa ja Ruotsi ovat ottaneet suurimman vastuun harteilleen", hän sanoi.
Helsingin Sanomat (http://www.hs.fi/ulkomaat/a1421819359147) 21.1.2015

Tekisi asialle jotain, eikä itkisi muiden tekemisiä. Mutta ei. Sisäministeri de Maizière julisti tänään, että Saksa ei aio muuttaa maahanmuuttopolitiikkansa millään tavalla, koska "meillä on jo laki".

Lainaus
But de Maiziere ruled out any changes to Germany‘s current immigration rules. "We have an immigration law and we do not need a new one," he said.
Europe Online Magazine: German immigration hits two-decade high; three-quarters from EU (http://en.europeonline-magazine.eu/german-immigration-hits-two-decade-high-three-quarters-from-eu_373355.html) 21.1.2015
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Peltipaita - 21.01.2015, 21:22:53
Kyllä köyhempiin maihin pitäisi saada suhteellisesti enemmän turvapaikanhakijoita kuin rikkaisiin.

Taas sama homma; rikkaat rikastuu, köyhät köyhtyy.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 21.01.2015, 21:34:12
Lainaus
risuja niille EU-maille, jotka "eivät tee osaansa" turvapaikan hakijoiden suhteen.

Tekemistä asian suhteen on sekin jos kieltäytyy avaamasta tulvaportteja. Tekemistä on jokainen yksittäistapaus oli myöntävä tai kieltävä päätös. Tekemistä on niinikään Afrikasta meren yli suuntautuvan ihmistsunamin vastaanoton kritisoiminen.

Tekemistä sen sijaan EI OLE ottaa vastaan kritiikittä jokainen meren ylittänyt laiton kulkuri ja sysätä se veronmaksajan harteille loppuelämäkseen tai siihen asti kunnes joku iskee kirveellä veronmaksajan kuoliaaksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: huhha - 21.01.2015, 22:24:30
Onko tänne saapuvat tupahat mahdollista myydä eteenpäin maksamalla kymppitonnin myötäjäiset? Se olisi aivan käsittämättömän loistavaa.

Se olisi myös vahva järjellisyyden signaali muille EU-maille ja kansainvälisille sijoittajille. Homer Simpsonin sanoin: "Oh, shut up and take my money already!!"
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 05.02.2015, 15:01:46
YK:n pakolaisjärjestö UNHCR:n pääsihteeri Antonio Guterres on vieraillut Ruotsissa. Pääsihteeri kiitteli vuolaasti Ruotsin pakolaispolitiikkaa, mutta vaati puheessaan EU:lle kiintiöjärjestelmää, joka pakottaisi muut EU-maat vastaanottamaan Ruotsiin tulleita turvapaikanhakijoita.

Lainaus
"Järjestelmässä on jotain vialla," sanoi Guterres, Portugalin entinen pääministeri, vaatien "eurooppalaista solidaarisuusmekanismia".

"Kiintiöjärjestelmät ovat aina äärimmäinen ratkaisu," hän lisäsi. "Ihannetapauksessa järjestelmä toimisi luontevasti niin, että se tuottaisi reilun jaon Euroopan maiden kesken."
The Local: UN asks EU to share Sweden's refugees (http://www.thelocal.se/20150203/un-says-eu-should-share-swedens-refugees) 3.2.2015

Xinhuanet: UNHCR chief calls for refugee quota system in (http://news.xinhuanet.com/english/europe/europe/2015-02/04/c_133967905.htm) EU 4.2.2015
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 17.02.2015, 20:22:33
Lainaus
Cecilia Wikstrom: A legal way to seek refuge in Europe

Over 50 million people are currently displaced in the world, many of them caught in a cold and harsh winter. One fifth of these are Syrians in urgent need of humanitarian assistance. Approximately 2 million of the Syrian refugees are living in refugee camps in Lebanon, Turkey, Jordan and Egypt, where access to medical care and medication is scarce.

Only about two percent of the refugees make their way to Europe. Most of them come through a dangerous boat ride across the Mediterranean Sea. I'm proud of the fact that Sweden last year granted asylum to 26,000 Syrians, just as many as Germany.

Meanwhile, the UNCHR reports that 3,419 people died on the perilous journey to Europe. It is a tragic record and it is clear that the Mediterranean Sea is now a sea of death, a giant graveyard of anonymous people united by a single desire - to save their lives.

I am overwhelmed by sadness over the fact that in the year of 2015 there are still no legal ways for refugees to be able to reach Europe in order to seek asylum. It is the desperation and the feeling of having nothing to lose that forces people to pay exorbitant sums to unscrupulous smugglers for a place on an unseaworthy, overcrowded boat.

The Dublin Regulation, which is based on the principle that the member state in which the asylum seeker first arrives should take responsibility for the person, gives a distorted distribution and I have to admit that the system is failing.

Today, five of the member states receive 70 percent of the asylum seekers - Sweden, Germany, UK, Italy, and France - while, for example, Estonia only received 10 people, Croatia 35, and Latvia 35 in 2013.

Quota system

It is time for a European quota system that distributes asylum seekers between member states, based on population, GNP and other relevant factors. However, it must be flexible and take into account people's individual situations such as family and kinship.

In this way we can maintain a common European asylum system that is legally secure and where all asylum seekers are ensured equitable treatment, while all member states have to take their share of the responsibility.

In the long term, I can also imagine that the European asylum authority - EASO - will have a broader mandate to manage all asylum applications at the EU level.

I, and many others with me, believe that it is a moral obligation for the EU to establish legal and safe routes to Europe for the people who need to escape war and persecution. We can do this for example by issuing humanitarian visas at EU embassies or consular offices in temporary refugee camps around the world.

It should also be mandatory for all the 28 member states in the European Union to participate in the UNHCR's resettlement program and thereby increase the number of quota refugees who are admitted to the EU.

Today there are 15 member states that do not receive any quota refugees at all, while Sweden receives 1,900 and Germany more than 5,000 per year.

If the remaining 26 member states were to follow these examples, we could spare 100,000 people the dangerous boat ride over the Mediterranean and offer them shelter in Europe.

All EU member states are bound by the Geneva Convention to give all asylum applicants a fair examination of their asylum claims and to never return a person if they risk persecution or torture.

No single person or country can single-handedly solve the horrific situation that characterizes the Syrian refugees' lives. But together, we can offer a better life for many more of the mothers, fathers, children and friends who are fleeing the horrors of Syria.

Together we can bring European solidarity to a new level. Europe must become a humanitarian superpower.

Cecilia Wikstrom is a Swedish liberal member of the European Parliament
EUobserver (https://euobserver.com/opinion/127613) 12.2.2015
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Eino P. Keravalta - 17.02.2015, 20:30:20
Cecilia W:

Lainaus
Europe must become a humanitarian superpower.

Jos Cecilia haluaa Euroopan olevan humanitäärisen supervallan, silloin hänen reseptinsä on totaalisen väärä: ottamalla Unioniin miljoonia sellaisia kehitysmaalaisia, joiden arvomaailmassa ei edes tunneta ihmisoikeuksien käsitettä, tuloksena ei ole mikään 'humanitäärinen supervalta', vaan etnisten konfliktien, heimosotien ja toisilleen vihamielisten enklaavien repimä helvetti, jossa kenenkään henki ei ole minkään arvoinen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 17.02.2015, 20:50:27
Cecilia W:

Lainaus
Europe must become a humanitarian superpower.

Jos Cecilia haluaa Euroopan olevan humanitäärisen supervallan, silloin hänen reseptinsä on totaalisen väärä: ottamalla Unioniin miljoonia sellaisia kehitysmaalaisia, joiden arvomaailmassa ei edes tunneta ihmisoikeuksien käsitettä, tuloksena ei ole mikään 'humanitäärinen supervalta', vaan etnisten konfliktien, heimosotien ja toisilleen vihamielisten enklaavien repimä helvetti, jossa kenenkään henki ei ole minkään arvoinen.

Cecilia W taitaa olla kiihottunut välimerellisen testosteronin supervoimista, lähinnä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Peltipaita - 17.02.2015, 21:01:26
Lainaus
"Kiintiöjärjestelmät ovat aina äärimmäinen ratkaisu," hän lisäsi. "Ihannetapauksessa järjestelmä toimisi luontevasti niin, että se tuottaisi reilun jaon Euroopan maiden kesken."

Suomessa bussit liikkuvat jo. Luultavasti myös Ruotsissa. Olisi reilua että koko euroopassa bussit liikkuisivat. Voisimme lahjoittaa omistamme muille siihen pisteeseen asti että kunnes bussit Suomessa ovat vaarassa pysähtyä. Melkoisen reilua.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 17.02.2015, 21:03:20
Lainaus
"Kiintiöjärjestelmät ovat aina äärimmäinen ratkaisu," hän lisäsi. "Ihannetapauksessa järjestelmä toimisi luontevasti niin, että se tuottaisi reilun jaon Euroopan maiden kesken."

Suomessa bussit liikkuvat jo. Luultavasti myös Ruotsissa. Olisi reilua että koko euroopassa bussit liikkuisivat. Voisimme lahjoittaa omistamme muille siihen pisteeseen asti että kunnes bussit Suomessa ovat vaarassa pysähtyä. Melkoisen reilua.

Jos vaan pidettäisiin Afrikan ja Lähi-idän bussit liikkeellä?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kulttuurirealisti - 17.02.2015, 21:07:29
Jos vaan pidettäisiin Afrikan ja Lähi-idän bussit liikkeellä?

Meillä ei ole oikeutta itsekkäästi pysäyttää Lähi-idän ja Afrikan busseja!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: niemi2 - 17.02.2015, 21:13:49
Lainaus
Europe must become a humanitarian superpower.

Cecilia haluaa epävakaan Euroopan tuomalla konfliktimaista ihmisiä, joille kofliktit ovat arkipäivää ja he vastustavat länsimaisia arvoja.

Cecilian sekopäisyys johtaisi vain sisällissotaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: chacha2 - 26.02.2015, 20:13:29
JHan väliaikatiedote (kopsattu hänen FB seinältään):

Lainaus

    Jussi Hallaaho
    53 mins ·

    UNHCR:n edustajat kävivät tänään Libessä antamassa väliaikakatsauksen turvapaikka-asioista. Euroopan maihin jätettiin viime vuonna 630 000 turvapaikkahakemusta. Edeltävänä vuonna määrä oli 390 000. Suurimpia kansallisuusryhmiä olivat syyrialaiset, irakilaiset, afgaanit ja eritrealaiset.

    46% hakemuksista jätettiin Saksaan ja Ruotsiin. Totesin puheenvuorossani, että tämä on hyvin mielenkiintoista ottaen huomioon kummankin maan sijainnin. Päästäkseen näihin maihin on kuljettava useamman turvalliseksi katsotun maan läpi.

    Kysyin myös näkemystä siihen, että vaikka taakanjakomekanismi ja "jakoavain" ("distribution key") saataisiin luotua, merkittävä osa "tasaisesti sijoitetuista" ihmisistä joka tapauksessa hakeutuisi vapaan liikkuvuuden turvin niihin maihin, jotka heidän näkökulmastaan ovat houkuttelevimpia. UNHCR:n edustaja myönsi tämän olevan todellinen ongelma; esimerkiksi johonkin Baltian maahan sijoitettu turvapaikanhakija voisi oleskeluluvan saatuaan lähteä Saksaan tai Ruotsiin.

    Ratkaisuksi on kaavailtu vastaanottajamaan ja henkilön välillä solmittavaa sopimusta, jonka mukaan henkilö palautettaisiin lähtömaahansa (siis esim. Syyriaan tai Irakiin), mikäli hän siirtyisi muutaman ensimmäisen vuoden aikana johonkin muuhun EU-maahan. Karenssin jälkeen hän toki olisi vapaa muuttamaan mielensä mukaan.

    "Jakoavaimen" kriteereitä olisivat mm. BKT, väestötiheys, aiemmin sijoitetut pakolaiset yms., joten Suomen kannalta mekanismi olisi mitä ilmeisimmin erityisen merkittävä (eli vahingollinen).

    Tämä väliaikatietona.

Yksi kommentoijista huomasi heti:
Lainaus
Käsitinkö mä nyt oikein, että EU:n tasolla ollaan pläänäämässä sitä samaa, mitä sä ehdotit Suomen tasolla ja mistä nousi julmettu möykkä?

Kyllä vain.



Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 01.03.2015, 12:29:36
Lainaus
President of the European Parliament Martin Schulz: 'We need a proper structure'

The president of the European Parliament says Europe needs to increase the humanitarian effort, but a political solution is needed in the long term.

"We need a complete new system of migration. Fifty per cent of all refugees are going to five member states of the European Union, which has 28 members.

"So what we need first of all is what we call 'burden sharing'. All member states of the European Union must contribute to manage this problem of refugees."

He says one way to reduce the number of people who die trying to get into Europe illegally is to make it easier for them to do so legally.

"We need rules for access to the European Union. Who will take how much quota of immigrants and which kind of immigrants get access to the European Union.

"This is for sure the better way than to allow illegal uncontrolled immigration."

Mr Schulz understands it is a hard political sell but argues national governments must be honest with their citizens.

"The question is: Is a government obliged to tell its citizens what they want to hear or what is the real need to explain?

"The Europeans must understand that we are in the beginning of a major change in the structure, not only of Europe, but the world as a whole with a lot of migration.

"People in this global world are moving and they will move also to Europe."
BBC: Can Europe stop migrants dying in the Mediterranean? (http://www.bbc.com/news/world-europe-31510336) 25.2.2015

Euroopan parlamentin puhemiehenä Anni Sinnemäki. Voimia Halla-aholle.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 01.03.2015, 16:19:06
Lainaus
The possibility of burden-sharing in the distribution of responsibility for processing asylum claims across the European Union (EU) seems to come up against a blockage when weighed against the principles and institutional practice underlying the Dublin system, the EU mechanism laying down the criteria determining the Member State responsible for processing an asylum claim. Understanding that blockage invites one to critically engage with the reasons why Member States have been reluctant to question Dublin as a policy option throughout the evolution of the Common European Asylum System (CEAS).

This paper explores this question by evaluating the Dublin system as a carrier of embedded interests which make it less likely for Member States to allocate processing responsibility on the basis of burden-sharing. It examines the Dublin system’s objectives, and its appropriateness in delivering them, under three tenets: deflection, efficiency and control. The paper submits that the mechanism’s peculiar interpretation of processing responsibility accounts for its failure to deflect asylum claims by creating incentives for defection from the allocation criteria, as well as by prompting courts to halt transfers to external border Member States intended to receive the bulk of applications.

The efficiency objectives of rapid processing of asylum claims and prevention of multiple applications and ‘asylum shopping’ are also not appropriately met, as the Dublin system causes significant delays in the processing of applications and provides asylum seekers with incentives to engage in irregular secondary movement. This built-in failure seems to reveal the symbolic objective of asserting control over entrants in their territory as the primary interest behind Member States’ support for Dublin.
‘We Need to Talk about Dublin’: Responsibility under the Dublin System as a blockage to asylum burden-sharing in the European Union - Working paper series No. 105 (http://reliefweb.int/report/world/we-need-talk-about-dublin-responsibility-under-dublin-system-blockage-asylum-burden) (37 sivua)

Lainaus
A second approach, commonly referred to as burden-sharing, would favour the design of a mechanism of collective responsibility, with a view to ensuring that responsibility for processing asylum claims is fairly and equitably distributed between all Member States in the Union on the basis of their respective reception capacities. Burden-sharing becomes highly pertinent against a backdrop of inequalities in the reception of asylum seekers in the EU. On one hand, the majority of asylum claims are shouldered by a limited number of Member States; over 50% of the total 434,000 asylum applications made in the Union’s 28 countries in 2013, for instance, were registered in Germany, Sweden and France alone (Eurostat 2014:4).At the same time, several Member States such as Greece, Bulgaria, Italy or Malta face significant pressures on their asylum systems’ reception capacities, calling for an EU-wide response.

The concept of burden-sharing is no new creature in the field of refugee protection. One could look to Article II (4) of the 1969 Organisation of African Unity (OAU) Refugee Convention, the Draft Council Resolution on Burden-Sharing tabled by the German Presidency in 1994 or even to academic suggestions on global burden-sharing mechanisms (Hathaway and Neve 1997) to find early appearances thereof in policy debates.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 26.03.2015, 19:26:04
https://www.facebook.com/jussi.hallaaho/posts/748071178646412 (https://www.facebook.com/jussi.hallaaho/posts/748071178646412)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 26.03.2015, 22:32:50
https://www.facebook.com/jussi.hallaaho/posts/748071178646412 (https://www.facebook.com/jussi.hallaaho/posts/748071178646412)

Ei varmaan mitään syytä jättää koko viestiä kopioimatta (korostukset minun):
Lainaus käyttäjältä: Jussi Halla-aho
Euroopan parlamentissa pidettiin eilen keskiviikkona "Save Lives" -seminaari, jonka aiheena olivat erilaiset taakanjakomallit. Tähän liittyviä ideoita tai alustavia esityksiä odotetaan tiettävästi myös komissiosta toukokuussa.

Lähtökohtana on, että Italian käynnistämät ja EU:n jatkamat meripelastusoperaatiot Välimerellä eivät ratkaise siirtolaispainetta vaan ainoastaan houkuttelevat lisää ihmisiä merelle. Kun vuonna 2013 keskisen Välimeren yli tuli 45 000 ihmistä, vuonna 2014 luku oli 170 000, ja tahti on jatkunut samanlaisena tänä vuonna.

Uusi strategia on ylläpitää Välimeren eteläpuolella, lähtö- ja kauttakulkumaissa, leirejä, joista käsin turvapaikkaa tai "humanitaarista viisumia" voisi hakea turvallisesti. Vastaanotettavien määrän pitäisi olla niin suuri, että se lopettaisi laittoman siirtolaisuuden tai ainakin vähentäisi sitä merkittävästi, mutta ei kuitenkaan niin suuri, että se ajaisi Euroopan maat poliittiseen kriisiin (millä tarkoitetaan äärioikeiston vahvistumista).

Ne tulijat, joille viisumi tai turvapaikka myönnettäisiin, jaettaisiin nykyistä tasaisemmin jäsenmaihin sitovalla, unionitasoisella mekanismilla. Jakokriteereinä olisivat esimerkiksi BKT, työttömyysaste, pinta-ala, väestön koko ja viimeisten viiden vuoden aikana vastaanotetut pakolaiset ja turvapaikanhakijat.

Kriteeristöstä on useita luonnoksia, mutta mikä tahansa niistä - luonnollisesti - johtaa Suomen osuuden merkittävään kasvuun nykyisestä. Esim. ICMPD:n (The International Centre for Migration Policy Development) mallissa Suomeen sijoitettaisiin 3,37% EU-alueelle tulevista humanitaarisista muuttajista, mikä vuosien 2009-2013 keskiarvoilla merkitsisi 11 000 henkeä vuodessa (+ perheenyhdistämiset). Tänä ja viime vuonna kokonaisluku on ollut suurempi, mikä tietysti näkyisi Suomenkin osuudessa.

Keskeinen ongelma taakanjakomekanismissa on se, miten sijoitetut pakolaiset saadaan pysymään heille osoitetussa jäsenmaassa. Lähes puolet kaikista turvapaikanhakijoista menee tällä hetkellä Ruotsiin ja Saksaan, ei siksi, että nämä maat olisivat sijaintinsa puolesta helposti saavutettavissa, vaan siksi, että ne ovat houkuttelevampia kuin muut. Osana omaa pilottihankettaan Puola sitoutui sijoittamaan Maltan leireiltä 75 syyrialaista pakolaista. Vain kahdeksan suostui tulemaan Puolaan. Heidän perässään tuli 15 perheenjäsentä. Puolen vuoden kuluessa kaikki olivat poistuneet maasta.

ICMPD:n mallissa esim. Viron tulisi vastaanottaa vuosittain 1500 pakolaista, kun maahan jätetään tällä hetkellä n. 60 turvapaikkahakemusta vuosittain. Virosta pääsee lautalla Suomeen ja Ruotsiin.

Ratkaisuksi ehdotetaan sijoitettavan henkilön allekirjoittamaa sopimusta, jossa tämä sitoutuu pysymään siinä maassa, joka hänelle on osoitettu. Teoreettisena sanktiona olisi palautus lähtömaahan. Tällaisen sopimuksen oikeudellinen sitovuus jääkin sitten nähtäväksi ja ihmisoikeusjuristien ja tuomioistuinten arvioitavaksi. On ainakin minulle epäselvää, millä keinoin, miten pitkään ja millä juridisella muskelilla voidaan estää unionin alueella laillisesti oleskelevia ihmisiä siirtymästä paikasta toiseen.

Tällaista näyttää nyt pukkaavan tosissaan.

Tuo 3,37 prosenttia tarkoittaisi viimevuotisella EU:n turvapaikanhakijamäärällä Suomeen 21 000 turvapaikanhakijaa. Jos jakokriteeriksi liitettäisiin myös Halla-ahon mainitsemat aiemmin vastaanotetut turvapaikanhakijat viiden vuoden aikaikkunalla, se laskettaisiin esimerkiksi tuosta 21 000:sta, joten Suomi ryhtyisi lisäksi sakkokiintiöllä kuromaan umpeen noin 90 000 turvapaikanhakijan "vajetta", eli Suomen kiintiö tuplattaisiin heti aluksi noin 40 000 turvapaikanhakijaan.

Mutta hys, käydään ensin vaalit, ja keskustellaan niissä vaikka työlupien tarveharkinnasta.

edit:
Tuolta jakokaavoja:
The International Centre for Migration Policy Development: An Effective Asylum Responsibility-Sharing Mechanism (http://www.icmpd.org/fileadmin/ICMPD-Website/ICMPD_General/Publications/2014/ICMPD_TP_Responsiblity_Sharing_October_FINAL.pdf) 10/2014 (pdf)

Merkittävin ongelma hankkeessa on pakolaispolitiikan päätösvallan luovuttaminen EU:lle. On samantekevää, mitä jakokaavat ovat aluksi, jos jäsenmaat luovuttavat päätösvallan turvapaikanhakijoiden hyväksymisestä ja sijoittamisesta EU-elimille. Hanketta ei suinkaan kannateta vain siksi, että sen oikeasti uskottaisiin auttavan pakolaisongelmaan, vaan myös siksi, että sen oletetaan osaltaan katkaisevan terän maahanmuuttokriittisten puolueiden nousulta, kun niiden kritisoimasta pakolaispolitiikasta ei enää päätettäisi kansallisissa parlamenteissa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 26.03.2015, 23:46:30
Miksi Suomen pitää olla mukana noissa päättävissä pöydissä? Eikö me pärjätä ilman?

Kun lasketaan yhteen eurostojäsenyyden plussia ja miinuksia, niin negatiivisen puolelle heilahtaa kyllä aika vahvasti. On vissiin epärealistista ajatella, että Suomi olisi itsenäinen valtio?

Sitten kun kansa vihdoin tulee järkiinsä, niin roskamaiden takauksista ja muista talouskupruista ehkä vielä selvitään siirtymällä omaan valuuttaan ja tekemällä aivan saatanasti töitä. Ulkosuhteetkin saadaan kuntoon vaihtamalla marionettipoliitikot sellaisiin, jotka ajattelevat omilla aivoillaan.

Mutta CEASin myötä käynnistyvä kansojen vaihto ja demografinen katastrofi ei ole korjattavissa. Siitä ei ole paluuta poliittisin keinoin, joten peli pitäisi viheltää poikki nyt heti. Valitettavasti suomalaisilla poliitikoilla ei ole kykyä, joten toivotaan, että muutos lähtee esimerkiksi Ranskasta, jossa Le Pen vaatii Shengenin ja itse asiassa koko arvoyhteisön alasajoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 26.03.2015, 23:50:40
Miksi Suomen pitää olla mukana noissa päättävissä pöydissä? Eikö me pärjätä ilman?

***

Miten minusta tuntuu, että 'päättävät pöydät' lapioivat kaiken paskansa sellaisten huijausten apukoululaisten, kuin Suomi, päälle?

Ihme juttu.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tosiasiallinen Nuiva - 26.03.2015, 23:57:50
Kuitenkin koko CEAS projektille voi sanoa ei eduskunnan päätöksellä. Täytyy vain äänestää Ps:a vaaleissa.

Lisäksi on syytä leikata pakolaisten tuet nollaan. Ei ne tänne jää, muuten kuin siinä tapauksessa, että perseellään istumisesta maksetaan tukia. Ikävä kyllä Keskustan häämöttävä vaalivoitto on tuomassa hallitukseen jälleen samat vanhat Vanhaset ja Väyryset, jotka mokuttivat viime vaalikaudella oikein urakalla.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 27.03.2015, 00:01:41
Miksi Suomen pitää olla mukana noissa päättävissä pöydissä? Eikö me pärjätä ilman?

***

Miten minusta tuntuu, että 'päättävät pöydät' lapioivat kaiken paskansa sellaisten huijausten apukoululaisten, kuin Suomi, päälle?

Ihme juttu.

Se on kallis hinta siitä, että Kataiset, Vapaavuoret ja muut pääsevät urahissillä taivaallisen komission kovapalkkaisiksi jäseniksi. Kaikki paska kaatuu meidän lasten niskaan aikanaan. Sitten joku kehtaa täällä ehdottaa vielä jäähyväisveroa pois muuttaville, ei hyvää päivää.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 27.03.2015, 00:08:35
Miksi Suomen pitää olla mukana noissa päättävissä pöydissä? Eikö me pärjätä ilman?

***

Miten minusta tuntuu, että 'päättävät pöydät' lapioivat kaiken paskansa sellaisten huijausten apukoululaisten, kuin Suomi, päälle?

Ihme juttu.

Se on kallis hinta siitä, että Kataiset, Vapaavuoret ja muut pääsevät urahissillä taivaallisen komission kovapalkkaisiksi jäseniksi. Kaikki paska kaatuu meidän lasten niskaan aikanaan. Sitten joku kehtaa täällä ehdottaa vielä jäähyväisveroa pois muuttaville, ei hyvää päivää.

Ensimmäisenä nämä verot tietenkin tulisi esitellä huipputuloisten virkakautensa kesken jättävien luottamustehtävien haltijoiden niskaan, vai eikö sittenkään?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Miniluv - 27.03.2015, 00:25:40
Olemme etusivulla. Pysytään asiassa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Tosiasiallinen Nuiva - 27.03.2015, 00:45:43
Laitetaan tähän vielä Halla-ahon facebook postaukseen vastanneen Nuutti Hyttisen ajatukset taakanjaosta ja humanitäärisistä viisumeista, kun joskus syntyi epäselvyyttä siitä, miten hän muka voi niitä kannattaa:

Lainaus
Jos laittomien maahantunkeutujien virta halutaan pysäyttää ja tehdä Eurooppaan pyrkimisestä omin lupineen vähemmän houkuttelevaa, toimivin ratkaisu olisi lisätä raja- ja merivartioston resursseja merkittävästi ja palauttaa kaikki laittomien maahanpyrkijöiden paatit takaisin Afrikan rannikolle. Jos EU-mailta jostain syystä puuttuu riittävä osaaminen, esimerkiksi Israelin laivasto pystyisi varmaankin sopivasta summasta auttamaan.

Niille, jotka tehostuneesta rajavalvonnasta huolimatta pääsevät keinolla tai toisella livahtamaan rajan yli Eurooppaan ilman asianmukaisia matkustusasiakirjoja, ei pitäisi myöskään missään tilanteessa myöntää oleskelulupaa, sosiaalituista puhumattakaan. Sen sijaan, että pohditaan, pitäisikö "paperittomilla" olla oikeus ilmaiseen terveydenhuoltoon, pitäisi pohtia, miksei ilman asianmukaisia henkilöllisyyspapereita maassa oleskelevia oteta säilöön ja karkoteta tavattaessa.

Turvapaikan tai "humanitäärisen viisumin" hakeminen lähtömaassa olisi nykyistä, täysin valvomatonta menoa parempi ratkaisu, mutta sen pitäisi tulla järjestelmänä nykymenon tilalle (eikä rinnalle) siten, että se olisi ainoa tapa päästä Eurooppaan, ja tapahtuisi täysin EU-jäsenmaiden ehdoilla. EU-jäsenmaiden sekä -kansalaisten etu on, että tiedetään ennalta, onko tänne pyrkivä henkilö terroristi tai muu rikollinen, eikä nykytila, jossa rajat vuotavat kuin seula.

Ei ole oikein eikä kohtuullista, että EU-maat auttavat niitä, jotka härskeimmin tänne tunkevat, eivätkä niitä, joilla hätä on suurin. Kriisiapu pitäisi toteuttaa niin, että samalla kustannuksella pystytään auttamaan mahdollisimman monia, ja se tapahtuu parhaiten parantamalla heidän olojaan paikan päällä, ei päästämällä härskeimpiä tyyppejä Eurooppaan elämään yhteiskunnan kustannuksella ja jättämällä ne, joilla ei ole varaa maksaa ihmissalakuljettajille, oman onnensa nojaan.

https://www.facebook.com/jussi.hallaaho/posts/748071178646412 (https://www.facebook.com/jussi.hallaaho/posts/748071178646412)

Boldaukset mun.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 27.03.2015, 02:28:00
Toteutuessaan jopa kymmenien tuhansien afrikkalaisten ja lähi-itäläisten invaasio vuositasolla merkitsisi noin 5 miljoonan suomalaisen, vain noin 2 miljoonan veronmaksajan, Suomen lopullista, ennennäkemätöntä tuhoa. Tuho tulisi jo ilman €urolamaakin, omallakin valuutalla. Puhumme afrikkalaistamisesta.

Suomen afrikkalaistaminen tuhoaisi kaiken, mitä me pidämme tällä hetkellä itsestäänselvyytenä; demokratian, verovaroilla ylläpidettävän yhteiskunnan - sosiaaliturvan, yhteiskuntarauhan, poliisin, pelastuslaitoksen, oikeuslaitoksen, rikosseuraamuslaitoksen, terveydenhuollon, vanhusten- ja lastenhoidon, puolustusvoimat, tullilaitoksen, julkisen liikenteen jne. jne. jne.

Kaikki rapautuisi hyvin nopeaan tahtiin jo parissa, kolmessa vuodessa - lopullisesti. Suomi olisi sitten kehitysavun tarpeessa oleva afrikkalainen valtio lopullisesti.

Ainoa seikka, mikä estäisi afrikkalaistamisen olisi luottoluokituksen romahtaminen lähelle roskaluokkaa niin, ettemme enää jakaisi ilmaista rahaa perustuslain mukaiselle "jokaiselle" planeetan kulkijalle, kuka sattuu Suomeen tulemaan. Siitä seurauksena olisi luonnollisesti jokaisen oikeus kuolla kaduilla kylmään ja nälkään.

Kysymys:

Onko Suomen afrikkalaistaminen väistämätön luonnontapahtuma, ja ellei ole niin, mitä meidän poliittiset päättäjämme ovat suunnitelleet lopullisen afrikkalaistamisen estämiseksi?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Isäntä ja loinen - 27.03.2015, 03:21:19
Ongelma meinataan siis todellakin "ratkaista" levittämällä se kaikkialle. Suomestakin on tulossa sen verran mielenkiintoinen maa, että luulisi taideyliopiston rehtorillekin kelpaavan.

Kaikkien suomalaisten pitäisi yhtenä rintamana asettua vastustamaan tätä hulluutta. Pelottavintahan tässä on se, että Suomestakin löytyy runsaasti sellaisia vaikutusvaltaisia poliitikkoja, toimittajia sekä elinkeino- ja kulttuurielämän edustajia, joiden mielestä tällainen väestönvaihtoprojekti on ihan ok. Tällaisen massiivisen uhkakuvan edessä suomalaisten tulisi pitää yhtä, mutta valitettavasti rivimme rakoilevat pahasti. Rakoilevat rivit tekevät Suomesta heikon.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 27.03.2015, 09:23:21
Laitetaan tähän vielä Halla-ahon facebook postaukseen vastanneen Nuutti Hyttisen ajatukset taakanjaosta ja humanitäärisistä viisumeista, kun joskus syntyi epäselvyyttä siitä, miten hän muka voi niitä kannattaa:

Lainaus
Turvapaikan tai "humanitäärisen viisumin" hakeminen lähtömaassa olisi nykyistä, täysin valvomatonta menoa parempi ratkaisu, mutta sen pitäisi tulla järjestelmänä nykymenon tilalle (eikä rinnalle) siten, että se olisi ainoa tapa päästä Eurooppaan, ja tapahtuisi täysin EU-jäsenmaiden ehdoilla.

Europarlamentissa ei käydä sellaista keskustelua, että humanitaaristen viisumien/turvapaikanhakukeskusten ehtona olisi EU-rajojen sulkeminen turvapaikanhakijoilta. Yhtä vähän kehotukselle nostaa jäsenmaiden pakolaiskiintiötä asetetaan vastaavia ehtoja.

Hyttinen antaa huolestuttavan viestin, kun tämä ymmärretään taatusti väärin (vrt. Pakolaisavun seminaari) sillä mikään taho ei ole esittänyt, että humanitaarisilla viisumeilla korvattaisiin nykyjärjestelmä. Se on tarkoitettu nykymenon täydentäjäksi päästämällä esim. kaikki syyrialaiset suoraan haluamaansa maahan Eurooppaan.

Turvapaikan hakeminen EU:n ulkopuolella lähetystöistä tai turvapaikanhakukeskuksista ei tapahtuisi sekään suunnitelmien mukaan EU-jäsenmaiden ehdoilla vaan EU:n ehdoilla. Suunnitelmissa jäsenmaat luopuisivat päätösvallastaan, jäsenmaiden turvapaikanhakukriteerien erot poistettaisin ja hakemukset käsiteltäisiin EU-elimissä EU:n määrittelemillä kriteereillä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ämpee - 27.03.2015, 09:23:49
Koko ongelma on jotenkin epätodellinen, joten ei ole ihme, että sen ratkaisun ehdoituskin on epärealistinen:

Lainaus
"Ratkaisuksi ehdotetaan sijoitettavan henkilön allekirjoittamaa sopimusta, jossa tämä sitoutuu pysymään siinä maassa, joka hänelle on osoitettu."

Näin siis odotetaan rehellisyyttä henkilöltä jonka henkilöllisyyttäkään emme tiedä.  :facepalm:

Ongelma sinällään on varsin nykyaikainen(?) sillä kaikissa julkisuuteen otetuissa kannoissa puututaan pelkästään ongelman seurauksiin, itse ongelmaan kajoamatta.
Varsinainen ongelma ei ole jaettavaksi ajateltujen(?) "siirtolaisten" määrä, vaan ylipäätään tämä €urooppaan tunkeutuminen illman mitään laillista perustetta.

Henkilökohtaisesti väittäisin, ettei rajavalvonnassa ole yhtään sellaista ongemaa mistä ampumalla ei selviä.
Jossain vaiheessa humanistisemmankin yhteiskunnan on alettava puolustautumaan, ja toivoisin sen tapahtuvan vielä silloin kun se yhteiskunta edelleen on humanistinen.
Aina ei voi voittaa, ei edes joka kerta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: LW - 27.03.2015, 10:04:37
Mikäli CEAS:iin liitetään nämä turvapaikanhakuleirit, esitetyt arviot Suomeen tulevista humanitäärisistä tapauksista ovat todennäköisesti reippaasti alakanttiin. Tulijavirtoihin vaikuttavat työntävät tekijät, eli käytännössä köyhyys ja konfliktit lähtömaissa, ja vetävät, eli kuinka helposti tänne pääsee, ja miten varmasti saa laillisesti täällä oleskelevan henkilön lukuisat etuudet. Työntäviin ei voi juuri vaikuttaa, mutta vetävät ovat kokonaan omassa kontrollissa, ja niitä oltaisiin tässä merkittävästi lisäämässä. On avoin kysymys, kuinka paljon ylimääräistä tulijavirtaa näillä leireillä tänne houkuteltaisiin. Se saattaa olla enemmän tai vähemmän kuin niiden kautta avautuva maahanmuuttokiintiö, mutta oli miten oli, laitonta maahanmuuttoa ei saa niillä loppumaan, ellei kiintiötä nosteta äärimmäisen korkeaksi, jopa rajattomaksi. Itse asiassa, jos leireille saapuu halukkaita tulijoita vuosittain monta kertaa enemmän kuin mitä niissä käsittellään, laiton maahanmuutto voi jopa kasvaa.

Suomen kannalta kyseessä olisi tietysti täysi katastrofi, ellei tulijoiden etuuksia tosiaan karsita itäeurooppalaiselle tasolle ja täten ajeta Ruotsiin, tai sanota EU:lle, että pitäkää tunkkinne, me lähdetään tästä läävästä. Tuollaisen siirron jälkeen jopa Venäjä alkaisi näyttää houkuttevalta vaihtoehdolta. Poliittinen eliitti ei taida tajuta, että tässä maassa on varsinaisten maahanmuuttokriittisten lisäksi huikeasti suurempi joukko, joka ei ole kovin innoissaan maailmanhalaamisesta etenkään nykyisessä taloustilanteessa, mutta ei jaksa nostaa asiasta isompaa meteliä (tai edes äänestää persuja), koska ihan ymmärrettävästi pitää muita asioita tärkeämpinä. Tällainen neronleimaus muuttaisi monien prioriteetit, ja pahoin pelkään, että se myös radikalisoisi useita täälläkin kirjoittavia.

Rakkaat päättäjät. Älkää sahatko oksaa, jolla tekin istutte. Pliis.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kni - 27.03.2015, 10:26:33
En ole lukenut koko ketjua, joten voi olla että tämä juttu jo jossakin täällä on, mutta koska se nokittaa EU:n luvut niin lisään silti:

Lännen media julkaisi 9.3.2015 kirjoituksen 'Perussuomalaiset ratsastaa taas maahanmuutolla'. Jutussa ei sinänsä ollut mitään uutta, mutta siihen liittyy toimittaja Mirja Niemitalon kommentti, mikä puolestaan on erittäin "mielenkiintoinen". Kirjoituksessa ehdotetaan, että maahanmuuttajien määrä sidottaisiin Suomessa syntyvien lasten määrään siten, että jokaista syntyvää vauvaa kohden otettaisiin yksi maahanmuuttaja. Esim. 55000 vuodessa. Tuolla meinigillä päästäisiin jo Ruotsin tunnelmiin.

Kirjoituksesta ei käy ilmi (ainakaan minulle) onko y.o. mielipide toimittajan oma vai Siirtolaisuusinstituutin johtajan Ismo Söderlingin. Jokainen voi kuitenkin miettiä mitä tuo tekisi Suomen väestölle, kun maahanmuuttajat alkaisivat lisääntyä heti ja nyt syntyvät suomalaisvauvat vasta noin 25-30 vuoden kuluttua.

Kommentti ei muutenkaan ole terävimmästä päästä, koska ensimäisessä lauseessa sanotaan ettei maahanmuuttajia ja pakolaisia saisi sekoittaa toisiinsa ja sitten lopussa kaikki taas niputetaan kuitenkin yhteen.

Vielä vuonna 2004 Söderling oli sitä mieltä, että EU:n ulkopuolisten tulijoiden määrä on sopiva eikä sitä pidä lisätä. http://www2.vaalikone.fi/euro2004/naytaehdokas.jsp?VP=1001&ehdokas=1048
Skannaus on Turun Sanomista.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: guest12632 - 27.03.2015, 11:19:56
Humanitäärisille viisumeille pitää sanoa tiukka ei. Yleensähän viisumeita myönnetään sellaisille henkilöille, jotka pystyvät tuomaan lisäarvoa yhteiskunnalle. Nyt olisi ajatuksena myöntää niitä kaikkein reppanoimmille. :facepalm: Kuten Roope totesikin, humanitääriset viisumit eivät ikinä tulisi korvaamaan nykyjärjestelmää vaan ne tulisivat sen rinnalle. Se olisi taas yksi instrumentti lisää mokuteollisuudelle ja niistä ei päästäisi ikinä eroon.  Ja kun järjestelmä saadaan rakennettua, niin sitä on helppo laajentaa ja kohta jokaisella afrikkalaisella on humanitäärinen viisumi.

Elintasopakolaisten virran patoamiseen on minusta vain yksi tehokas keino: pakolaisleirit Afrikkaan. Se ratkaisisi monta ongelmaa: 1. pakolaiset olisivat siellä turvassa, joten humanitäärinen puoli täyttyy 2. kulut olisivat murto-osa, joten pystyttäisiin auttamaan kymmenkertaista määrää ihmisiä 3. turvapaikkajärjestelmän hyväksikäyttö elintasopakolaisuuteen loppuisi, koska kaikki turvapaikanhakijat kuljetettaisiin leireille, joka olisi myös heidän lopullinen asuinpaikkansa, jos he saavat turvapaikan. Toki pakolaisleiritkin käyvät pitkällä tähtäimellä riittämättömiksi, jos väestöräjähdys Afrikassa jatkuu.

Kirjoituksessa ehdotetaan, että maahanmuuttajien määrä sidottaisiin Suomessa syntyvien lasten määrään siten, että jokaista syntyvää vauvaa kohden otettaisiin yksi maahanmuuttaja. Esim. 55000 vuodessa. Tuolla meinigillä päästäisiin jo Ruotsin tunnelmiin.

Olen itsekin miettinyt tätä, mutta täysin eri luvuilla. Jos mamuja otettaisiin vaikka semmoinen 1% syntyvien lapsien määrästä, niin mamupopulaatio pysyisi kurissa, eikä kyseessä olisi väestön vaihto.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Nikolas - 28.03.2015, 14:37:34
Parasta tässä asiassa olisi, jos Euroopan unioni ymmärtäisi tehdä samoin kuin Australia, eli ulkoistaisi pakolaisten majoituksen sopivan etäisiin maihin, jolloin elintasopakolaisten ja sosiaalishoppailijoiden virta tyrehtyisi ja vain todelliset turvapaikanhakijat edelleen hakisivat turvaa. Olen katsonut joitain Etelä-Afrikan tasavallan naapureita sillä silmällä, että ne saattaisivat kelvata tähän tarkoitukseen. Tietenkin ne haluaisivat tästä hyvästä korvauksen, mutta nämä ovat sellaisia neuvoteltavia asioita, ja kumminkin ne olisivat Euroopalle paljon edullisempia kuin "pakolaisten" vyöryn vastaanottaminen ja sijoittaminen Euroopan maihin.

Epärealististako? Noh, vaihtoehtona olisi Suomen eroaminen Euroopan unionista, ja siihen on kyllä valmiiksi muitakin hyviä perusteluja.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Miniluv - 28.03.2015, 15:15:01
Australia onnistui näin vielä lopettamaan hengenvaarallisilla paateilla seilaamisenkin.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 15:42:48

Turvapaikan tai "humanitäärisen viisumin" hakeminen lähtömaassa olisi nykyistä, täysin valvomatonta menoa parempi ratkaisu, mutta sen pitäisi tulla järjestelmänä nykymenon tilalle (eikä rinnalle) siten, että se olisi ainoa tapa päästä Eurooppaan, ja tapahtuisi täysin EU-jäsenmaiden ehdoilla. EU-jäsenmaiden sekä -kansalaisten etu on, että tiedetään ennalta, onko tänne pyrkivä henkilö terroristi tai muu rikollinen, eikä nykytila, jossa rajat vuotavat kuin seula.

Ei ole oikein eikä kohtuullista, että EU-maat auttavat niitä, jotka härskeimmin tänne tunkevat, eivätkä niitä, joilla hätä on suurin. Kriisiapu pitäisi toteuttaa niin, että samalla kustannuksella pystytään auttamaan mahdollisimman monia, ja se tapahtuu parhaiten parantamalla heidän olojaan paikan päällä, ei päästämällä härskeimpiä tyyppejä Eurooppaan elämään yhteiskunnan kustannuksella ja jättämällä ne, joilla ei ole varaa maksaa ihmissalakuljettajille, oman onnensa nojaan.

https://www.facebook.com/jussi.hallaaho/posts/748071178646412 (https://www.facebook.com/jussi.hallaaho/posts/748071178646412)





Nuutti Hyttinen näyttää olevan liian nuori ja liian naiivi politiikkaan.

Jo se että kannattaa joissain teorettisissa tilanteissa täydellistä järjettömyyttä kuten humanitaarisia viisumeita antaa syötön pähkähullujen lapaan koska a) humanitaarisen viisumin kannattajat voivat siinä uutisruuhkassa mikä media nykyään on vedota siihen että persutkin kannattaa jolloin Nuutti Hyttinen juuri maksoi persuille erittäin paljon äänestäjiä b) nykyisen median uutisruuhkan ansiosta ei Nuutti tai persut tule ikinä pääsemään perustelemaan mielipidettään ja vaikka pääsisikin niin 95% äänestäjille tuo Nuutin kannanotto on liian monimutkainen tajuttavaksi kiireessä joten assosiaatio ilman median väritystä on todennäköisesti persut kannattaa humanitaarisia viisumeita ja median värityksen kanssa assosiaatio on VARMASTI persut kannattaa humanitaarisia viisumeita c)jos persut vastustaa humanitaarisia viisumeita kun Keskusta/SDP/Kokoomus konsensuksesta niitä joku aikanaan ehkä esittää taivuttuaan jälleen kerran asianajajien "ihmisoikeus"-järjestöjen lobbaukseen ja vasemmiston ja vihreiden rääkyessä kuinka ihmisiä hukkuuu välimereen niin sitten "kannanmuutos" voidaan esittää niin että persut ovat muuttuneet rasisteiksi.

Nuutti ei ole näköjään oppinut että pähkähulluuksia EI IKINÄ kannata kannattaa edes teorettisissa pohdiskeluissa.

Lisäksi se että humanitaarinen viisumi olisi Nuutin mielestä parempi ratkaisu kuin nykyinen meno osoittaa että hänellä ei ole suhteellisuudentajua sillä nykyisin sadat tuhannet välimeren ylittäjät maksavat tuhansia ja kymmeniä tuhansia eurooppaan pääsystään mutta jos pitäisi vain vaeltaa afrikan sisällä tiettyyn pisteeseen niin tulijoita olisi miljoonia ja jos humanitaarisen viisumin voisi hakea suurlähetystöistä niinkuin humanitaarisen viisumin lobbaajien tavoitteena on niiin tulijoita olisi kymmeniä miljoonia vuodessa.
Ja jos luulee että humanitaarisen viisumin tultua käytännöksi sillä tulijoita jotenkin rajoitettaisiin nykyisessä eurooppalaisessa poliiitttisessa kentässä ja mediakentässä niin ei ymmärrä mistään mitään.

Itse toivon että Halla-aho vetää äänestys-suosituksensa pois sillä olen sitä mieltä että jos Nuutilta tulee tällaisia vaikeaselkoisia ja helposti persuille ja maahanmuuttokriittisyydelle mahdollisimman haitallisesti tulkittavia kannanottoja nyt niin eduskuntaan päästessään on suuri mahdollisuus että hän jatkaa samanlaista asioiden sähläämistä ja monimutkaistamista teoreettisilla pohdinnoilla ja ampuu kaikkia maahanmuuuttokriittisiä kollektiivisesti jalkaan.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 15:59:30
Jos alkaa keskustelemaan siitä MITEN EU:n yhteinen pakolaispolitiikka pitäisi toteuttaa niin on jo mennyt juuri siihen laatikkoon johon humanitaarisen viisumin ja EU:n yhteisen pakolaispolitiikan lobbaajat kaikki maahanmuuttokriittiset haluavatkin johdatella sillä silloin todellakin keskustellaan siitä MITEN kyseinen asia toteutetaan eli oletukseksi ihmisten mielissä muodostuu että tämä toteutetaan ja se passivoi maahanmuuttokriittisiä äänestäjiä ja maahanmuuttokriittiset tulevat 100% varmasti häviämään keskustelun siitä miten pähkähulluus toteutetaan eli tuloksena on että maahanmuuttokriittiset tuhosivat poliiittisen uskottavuutensa, poliittisen vaikutusvaltansa ja EU:lle tuli täysin järjetön ja pähkähullu pakolaispolitiikka joko heti yhteisen politiikan tultua voimaan tai hivuttamalla pikkuhiljaa niinkuin järjettömyydet yleensä tehdään.

Yhteistä EU:n pakolaispolitiikkaa on vastustettava VIIMEISEEN asti sillä jos se menee läpi niin äänestäjät suomessa eivät voi enää vaikuttaa äänestämällä suomen maahanmuuttopolitiikkaan.

Aikooko Halla-aho kirjoitella facebookissa vai nostavatko Halla-aho ja muut maahanmuuttokriittiset tämän asian paljon näkyvämmin esille?

Julkisen poliittisen keskustelun puute mahdollistaa järjettömyydet sillä jos keskusta/kokoomus/SDP eivät joudu ottamaan kantaa niin ne saavat äänet ja voivat vaalien jälkeen tehdä mitä tahansa mutta jos ne joutuvat ottamaan kantaa niin ne joko menettävät äänestäjiä tai ovat julkisesti sitoutuneet järkevään politiikkaan siksi maahanmuuttokriittisten täytyy nostaa aihe näkyviin ja niin hyvin muotoilluksi että se on helppo tajuta ja Keskusta/Kokoomus/SDP saadaan ottamaan siiihen julkisesti kantaa.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 16:15:21
Tässä Nuutti Hyttisen koko facebook kommentti:

Lainaus
Nuutti Hyttinen Jos laittomien maahantunkeutujien virta halutaan pysäyttää ja tehdä Eurooppaan pyrkimisestä omin lupineen vähemmän houkuttelevaa, toimivin ratkaisu olisi lisätä raja- ja merivartioston resursseja merkittävästi ja palauttaa kaikki laittomien maahanpyrkijöiden paatit takaisin Afrikan rannikolle. Jos EU-mailta jostain syystä puuttuu riittävä osaaminen, esimerkiksi Israelin laivasto pystyisi varmaankin sopivasta summasta auttamaan.

Niille, jotka tehostuneesta rajavalvonnasta huolimatta pääsevät keinolla tai toisella livahtamaan rajan yli Eurooppaan ilman asianmukaisia matkustusasiakirjoja, ei pitäisi myöskään missään tilanteessa myöntää oleskelulupaa, sosiaalituista puhumattakaan. Sen sijaan, että pohditaan, pitäisikö "paperittomilla" olla oikeus ilmaiseen terveydenhuoltoon, pitäisi pohtia, miksei ilman asianmukaisia henkilöllisyyspapereita maassa oleskelevia oteta säilöön ja karkoteta tavattaessa.

Turvapaikan tai "humanitäärisen viisumin" hakeminen lähtömaassa olisi nykyistä, täysin valvomatonta menoa parempi ratkaisu, mutta sen pitäisi tulla järjestelmänä nykymenon tilalle (eikä rinnalle) siten, että se olisi ainoa tapa päästä Eurooppaan, ja tapahtuisi täysin EU-jäsenmaiden ehdoilla. EU-jäsenmaiden sekä -kansalaisten etu on, että tiedetään ennalta, onko tänne pyrkivä henkilö terroristi tai muu rikollinen, eikä nykytila, jossa rajat vuotavat kuin seula.

Ei ole oikein eikä kohtuullista, että EU-maat auttavat niitä, jotka härskeimmin tänne tunkevat, eivätkä niitä, joilla hätä on suurin. Kriisiapu pitäisi toteuttaa niin, että samalla kustannuksella pystytään auttamaan mahdollisimman monia, ja se tapahtuu parhaiten parantamalla heidän olojaan paikan päällä, ei päästämällä härskeimpiä tyyppejä Eurooppaan elämään yhteiskunnan kustannuksella ja jättämällä ne, joilla ei ole varaa maksaa ihmissalakuljettajille, oman onnensa nojaan.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.03.2015, 16:18:45
Jos alkaa keskustelemaan siitä MITEN EU:n yhteinen pakolaispolitiikka pitäisi toteuttaa niin on jo mennyt juuri siihen laatikkoon johon humanitaarisen viisumin ja EU:n yhteisen pakolaispolitiikan lobbaajat kaikki maahanmuuttokriittiset haluavatkin johdatella

Juuri näin. EU:n yhteistä pakolaispolitiikkaa ja turvapaikkajärjestelmää ovat ilmoittaneet kannattavansa Kokoomus, Keskusta, Sdp, Vihreät, Vasemmistoliitto, Rkp ja Kristillisdemokraatit, mutta ne eivät tule oma-aloitteisesti kertomaan, mitä suunnitelmien toteutus merkitsisi Suomelle ja Euroopalle. Jos pöydällä on talous, niin silloin samalla pöydällä on välttämättä oltava myös suunnitelmat jopa satojen tuhansien (3,37 % => 21 000 vuonna 2014) turvapaikanhakijoiden ja pakolaisten siirtämisestä Suomeen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 16:49:01
Jos alkaa keskustelemaan siitä MITEN EU:n yhteinen pakolaispolitiikka pitäisi toteuttaa niin on jo mennyt juuri siihen laatikkoon johon humanitaarisen viisumin ja EU:n yhteisen pakolaispolitiikan lobbaajat kaikki maahanmuuttokriittiset haluavatkin johdatella

Juuri näin. EU:n yhteistä pakolaispolitiikkaa ja turvapaikkajärjestelmää ovat ilmoittaneet kannattavansa Kokoomus, Keskusta, Sdp, Vihreät, Vasemmistoliitto, Rkp ja Kristillisdemokraatit, mutta ne eivät tule oma-aloitteisesti kertomaan, mitä suunnitelmien toteutus merkitsisi Suomelle ja Euroopalle. Jos pöydällä on talous, niin silloin samalla pöydällä on välttämättä oltava myös suunnitelmat jopa satojen tuhansien (3,37 % => 21 000 vuonna 2014) turvapaikanhakijoiden ja pakolaisten siirtämisestä Suomeen.

Juuri näin.

Tämän takia maahanmuuttokriittisten PITÄÄ nostaa asia niin näkyvästi esille ennen vaaleja että kaikki puolueet joutuvat ottamaan julkisesti kantaa ja nämä kannanotot leviävät äänestäjille jotta joko puolueet menettävät ääniä järjettömien suunnitelmien tukemisen takia ja persut saavat kyseisiä äänestäjiä omiksi äänestäjikseen TAI puolueet sanovat julkisesti vastustavansa järjettömiä suunnitelmia jolloin on edes jonkinlainen pidäke välttää hulluimpien sekopäisyyksien toteuttamista vaalien jälkeen.

Juuri siksi Nuutti Hyttisen omaan näppäryyteensä sotkeutuva monimutkainen teorisointi on täyttä myrkkyä maahanmuuttokriittisyydelle.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 16:54:40
Nuutti Hyttisen asiaa sekoittavaa ja yhteisen EU:n pakolaispolitiikan toteutumista edistävää kommentointia lisää:

Lainaus
"täysin EU-jäsenmaiden ehdoilla" = jokainen jäsenmaa päättää itsenäisesti, paljonko ulkomaalaisia ottaa vastaan ja millä kriteerein.

Humanitäärisen maahanmuuton rahoittamiseksi ainoa oikea keino olisi sen kannattajilta perittävä vapaaehtoinen vero, jonka tulisi kattaa kaikki humanitäärisen maahanmuuton kustannukset. Into kyseenalaiseen maailmanparantamiseen voisi nopeasti vähentyä, kun muiden verovarojen sijasta pääsisivät jakamaan omia verovarojaan ja nostamaan omaa veroprosenttiaan.


Jos sekoittaa asiaa ehdotuksilla jotka EIVÄT 100% varmasti tule menemään läpi ja ohjaa siten keskustelua epäolennaisuuksiin niin toimii maahanmuuttokriittisyyttä vastaan!

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Sitruunamelissa - 28.03.2015, 17:07:24
Jos yhteinen pakolaispolitiikka (joka tulee todellisuudessa olemaan "kaikki vaan Eurooppaan"-siirtolaispolitiikkaa) toteutuu, talousaspekti on tärkeä, ja se on jo otettu esille. Yhtä tärkeä on se, että tilanne tulee menemään siihen, että Ruotsin malliin kuntien on pakko ottaa vastaan niille määrätty määrä tulijoita. Tähän astihan nämä hankkeet ja tulijoiden määrä ovat olleet kuntien päätettävänä, mutta eivät sitten enää tulevaisuudessa, jos Suomelle määrätään jopa kymmeniätuhansia tulijoita vuodessa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 28.03.2015, 17:23:57
Tähän astihan nämä hankkeet ja tulijoiden määrä ovat olleet kuntien päätettävänä, mutta eivät sitten enää tulevaisuudessa, jos Suomelle määrätään jopa kymmeniätuhansia tulijoita vuodessa.

Hyvä huomio. Astrid Thorshan väläytti maahanmuuttoministerinä vastaanottopakkoa, mutta joutui nopeasti perääntymään. Puolueista pakkoa on ajanut vain Vihreät, mutta sekin aika vähin äänin. Kepin sijaan on tarjottu toistaiseksi porkkanaa. Pakolaiskorvaukset on muutamassa vuodessa tuplattu, ja kunnassa asuvien maahanmuuttajien ("vieraskielisten") määrän perusteella maksettava valtionosuus kymmenkertaistettiin vuoden alussa puoleen miljardiin euroon. Toisaalta esimerkiksi Helsingissä ja Tampereella on jo niin älyvapaat kuntapäättäjät, että ottavat vastaan vaikka tuhansia pakolaisia, jos valtio vähän vinkkaa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Skeptikko - 28.03.2015, 17:49:02
Parasta tässä asiassa olisi, jos Euroopan unioni ymmärtäisi tehdä samoin kuin Australia, eli ulkoistaisi pakolaisten majoituksen sopivan etäisiin maihin, jolloin elintasopakolaisten ja sosiaalishoppailijoiden virta tyrehtyisi ja vain todelliset turvapaikanhakijat edelleen hakisivat turvaa. Olen katsonut joitain Etelä-Afrikan tasavallan naapureita sillä silmällä, että ne saattaisivat kelvata tähän tarkoitukseen. Tietenkin ne haluaisivat tästä hyvästä korvauksen, mutta nämä ovat sellaisia neuvoteltavia asioita, ja kumminkin ne olisivat Euroopalle paljon edullisempia kuin "pakolaisten" vyöryn vastaanottaminen ja sijoittaminen Euroopan maihin.

Vaikka tämä ehkä onkin aika epätodennäköistä, niin tällainen olisi toivottava ratkaisu. Mallina voisi olla sellainen, että kaikki tänne omin nokkineen pyrkivät lähetettäisiin tuonne Afrikkaan majoitukseen, mikä tyrehdyttäisi varmaan pian nämä vaaralliset meriteitse tapahtuvat salakuljetukset. Afrikan leiriltä voitaisiin sitten mahdollisesti valita pieni määrä kiintiöpakolaisia vuosittain vaikkapa arpomalla ja epäonnisimmat olisivat vapaita lähtemään jonnekin muualle kuin Eurooppaan onneaan kokeilemaan. Eräänä valintakriteerinä voitaisiin myös pitää sitä, että opettelee kohtuuajassa suomen kielen siellä leirillä yms välttämättömiä taitoja.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: tutkimus - 28.03.2015, 19:03:45
Tähän astihan nämä hankkeet ja tulijoiden määrä ovat olleet kuntien päätettävänä, mutta eivät sitten enää tulevaisuudessa, jos Suomelle määrätään jopa kymmeniätuhansia tulijoita vuodessa.

Hyvä huomio. Astrid Thorshan väläytti maahanmuuttoministerinä vastaanottopakkoa, mutta joutui nopeasti perääntymään. Puolueista pakkoa on ajanut vain Vihreät, mutta sekin aika vähin äänin. Kepin sijaan on tarjottu toistaiseksi porkkanaa. Pakolaiskorvaukset on muutamassa vuodessa tuplattu, ja kunnassa asuvien maahanmuuttajien ("vieraskielisten") määrän perusteella maksettava valtionosuus kymmenkertaistettiin vuoden alussa puoleen miljardiin euroon. Toisaalta esimerkiksi Helsingissä ja Tampereella on jo niin älyvapaat kuntapäättäjät, että ottavat vastaan vaikka tuhansia pakolaisia, jos valtio vähän vinkkaa.

Saisinko linkin tähän valtionosuuksien kymmenkertaistamiseen?

Tämähän on selvästi maahanmuutosta aiheutuva kustannus 500 miljoonaa euroa vuodessa ja tämä pitää saada leviämään.


Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 29.03.2015, 15:29:28
Saisinko linkin tähän valtionosuuksien kymmenkertaistamiseen?

Kun kaksikielisyyden eli käytännössä ruotsinkielisten määrän perusteella jaettava tuki oli vanhassa mallissa 53 miljoonaa euroa, on se uudessa mallissa 91 miljoonaa euroa. Vastaavasti vieraskielisyyden eli maahanmuuttajien määrän perusteella jaettava tuki oli vanhassa mallissa 45 miljoonaa euroa, mutta uudessa mallissa 479 miljoonaa euroa.

Lainaus
Kaksikielisyys:
Kaksikielisille kunnille = kaksikielisyyden hinnasta 7 % koko asukasluvun perusteella ja 93 % ruotsinkielisen väestön perusteella.

Vieraskielisyys:
Kunnan kerroin = kunnan vieraskielisten osuus vähennettynä sen kunnan osuudella, jonka osuus maan alin.

Valtiovarainministeriö: Valtioneuvosto hyväksyi valtionosuusuudistuksen (http://www.vm.fi/vm/fi/05_hankkeet/0107_kuntauudistus/07_vos/index.jsp) 17.4.2014

Uuden valtionosuusjärjestelmän kuntakohtaiset muutoslaskelmat ja muu tietoaineisto: Uusi valtionosuusjärjestelmä (http://www.vm.fi/vm/fi/04_julkaisut_ja_asiakirjat/03_muut_asiakirjat/20140417Uusiva/Uusi_valtionosuusjaerjestelmae.xls) (xls)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Gamma - 29.03.2015, 20:57:17
Jos aidosti halutaan säädellä ylikansallista taakanjakoa humanitaarisista lähtökohdista, järjestelmän pitäisi olla maailmanlaajuinen ja sellainen, että suurin osan kulloisenkin kriisialueen pakolaisista jäisi kulttuuris-maantieteellisesti lähialueille ja muilta osin ohjautuisi sellaisille alueille, joissa heillä olisi parhaat mahdollisuudet saada koulutustaan vastaavaa työtä. Taakanjaon raamit määriteltäisiin vaikkapa YK:n turvallisuusneuvostossa. Ei ole mitään järkeä että vain EU:n jäsenvaltiot pakotettaisiin muokkaamaan omaa lainsäädäntöään taakanjakoa vastaavaksi, koska kyse on maailmanlaajuisesta ongelmasta.

Ymmärrän että todellisuudessa kyse on lähinnä halusta saada turvapaikanhakijoista nopeasti halpatyövoimaa sosiaalisen koheesion kustannuksella (vaikka näiden työllistämiseen menisi 10 vuotta, se on silti vähemmän kuin suomalaisen työvoiman tarjonnan kasvattaminen vauvasta alkaen ja sosiaalisen koheesion heikkeneminen näkyy puolestaan enemmän heikkenevänä elämänlaatuna kuin lisääntyvinä kilpailukykykustannuksina), mutta tällaisia raadollisia taka-ajatuksia ei kannattaisi pahemmin piilotella ylevien humanitaaristen tavoitteiden taakse. Kaikki tiedämme, että ns. turvapaikanhakijat päätyvät usein halpatyövoiman asemaan, vaikka olisivat lähtömaassaan suhteellisen hyvin koulutettujakin. EU.sta halutaan tehdä heikommassa asemassa olevien ihmisten hyväksikäyttämisen supervalta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ämpee - 30.03.2015, 11:27:21
Ihana ja kaikelle tulevaisuuden hyvälle aivan välttämätön maahanmuutto on kultamunan lailla kuoriutumassa taakaksi jota pitää jakaa.
Aiemmin tätä maahanmuuttoa oikein vaadittiin, nyt se on taakka jota pakon(??) edessä täytyy(??) jakaa.

Odottelemme monikulttuuri-kultamunan kuoriutumista sekakulttuuriksi, jolloin sekin on taakka jota pitää jakaa.
Tosin mielenhäiriöisten toiveiden toteutuessa koko maailma on yhtä ja samaa sekakulttuuria, joten ei enää ole paikkaa mihin tätä "ilonsanomaa" voisi jakaa.

Omalla tavallaan on erittäin outoa, että tämä joukkomielenhäiriö on näinkin laajalle levinnyt, mutta toisaalta se kuvastaa nykyisen politiikan vaihtoehdottomuutta, siis sitä, että kuinka nykyistä politiikkaa edistävät puolueet ovat näennäisestä erilaisuudestaan huolimatta putkahtaneet maailmaan aivan samasta muotista.

Sekakulttuuri on kuin monirotuinen koira jota koitetaan tyrkyttää koiranäyttelyyn, vaikka sen perimässä ei ole yhtään ansiota mutta kaikki mahdolliset virheet.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: hiemannuivis - 04.04.2015, 10:05:45
20 000 + yhdistämiset, joku älyn jättiläinen ehdotti jopa 55 000 aikuisen vuosittaista hyysättäväksi ottamista.. Mihinkähän tämmöinen jopa Vaasan kokoisen kaupungin vuosittainen tulijamäärä oikein aiotaan sitten majoittaa? Todellisuudessa tuokin väestönsiirto keskittyisi eteläiseen Suomeen.  Sveduilla Tukholmassa on jopa10 vuoden jono vuokra-asuntoihin, mutta täällä meillä varmaankin nämä valopäät pystyvät ratkaisemaan tälläisenkin pikkuseikan vuorenvarmasti  :facepalm: Tulipa sekavaa sisältöä, mutta vituttaa niin, ettei veri kierrä!
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 08.04.2015, 17:56:22
Lainaus
EU:n yhteinen turvapaikka- ja maahanmuuttopolitiikka – missä mennään?

Suomi, kuten EU, tarvitsee sekä jatkuvaa työperusteista maahanmuuttoa että vapaan liikkuvuuden tuomaa moninaisuutta. Globaalissa maailmassa sulkeutunut ja ikääntyvä Suomi ei pärjää. Pakolaispolitiikkamme tulee taas perustua ihmisten oikeudelle hakea turvaa vainon kohteeksi joutuessaan.
...

On luotava enemmän laillisia saapumisreittejä etenkin kansainvälistä suojelua tarvitseville. Esimerkiksi Suomen pitäisi myöntää humanitaarisia viisumeita, joiden avulla voi matkustaa turvallisesti Suomeen hakemaan turvapaikkaa.
...

Dublin-asetusta tuleekin muuttaa, jotta turvapaikanhakijoita ei enää palauteta maihin, joissa olot ovat heille huonot. Tarvitaan myös uusia keinoja lisätä solidaarisuutta EU-maiden välillä, jotta maahanmuutto ei rasita kohtuuttomasti yksittäisiä maita.
...

Esimerkiksi ilmastopakolaisia arvellaan vuoteen 2050 mennessä olevan 50 miljoonasta miljardiin. Tanska, ensimmäisenä Euroopan maana, on jo myöntänyt ilmastopakolaisille oleskelulupia. Suomessakin lainsäädäntö mahdollistaisi tämän. Ilmastopakolaisille on myönnettävä kansainvälisesti virallinen asema, joka poliittista vainoa pakenevilla on.
...

Pakolaiskiintiötä tulee nostaa nykyisestä.
...

Pakolaisten perheenyhdistämisestä on tehty liian vaikeaa, mihin pitää tulla muutos.
...

Heidi Hautala, MEP ja Mervi Haakana, eduskuntavaaliehdokas 133, Kaakkois-Suomi

Mervi Haakana (http://mervihaakana.fi/?p=217)

Olen kaikista näistä asioista täysin päinvastaista mieltä kirjoittajien kanssa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: koli - 08.04.2015, 18:08:56
Lainaus
Tanska, ensimmäisenä Euroopan maana, on jo myöntänyt ilmastopakolaisille oleskelulupia.

Onko oikeasti? Eikö Tanskassa pitänyt olla tolkuissaan oleva hallitus?

Googgeloin ja ainakin 2009 näin on vielä ollut:
Lainaus
Tanska on ainoa Euroopan maa, joka ottaa vastaan ilmastopakolaisia. Useat Afganistanista ja Itä-Afrikasta lähteneet ihmiset ovat saaneet Tanskassa oleskeluluvan nimenomaan kotimaansa äärimmäisten ilmasto-olosuhteiden takia, kirjoittaa tanskalainen sanomalehti Berlingske Tidende.
http://yle.fi/uutiset/tanska_ottaa_vastaan_ilmastopakolaisia/5971230
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 08.04.2015, 20:10:42
Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
Pakolaisten ihmisoikeuksia ja heidän oikeuttaan turvapaikkaan on kunnioitettava. Ei voi olla niin, että heidän annetaan hukkua Välimereen.

Pakolaisten oikeuksiin ei kuulu saada turvapaikkaa haluamastaan maasta. Suojaa voidaan antaa myös EU:n ulkopuolella.

Millä keinoilla Vihreät estäisi ihmisiä hukkumasta Välimereen, etenkin kun tiedämme, että kaikki tulijat eivät suinkaan ole pakolaisia tai edes turvapaikanhakijoita?

Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
On luotava enemmän laillisia saapumisreittejä etenkin kansainvälistä suojelua tarvitseville. Esimerkiksi Suomen pitäisi myöntää humanitaarisia viisumeita, joiden avulla voi matkustaa turvallisesti Suomeen hakemaan turvapaikkaa.

Humanitaarisiin viisumeihin liittyy monia ongelmia kuten esimerkiksi se, että Suomi ei nykyisin pysty käännyttämään monia sellaisia turvapaikanhakijoita, joiden ei katsota olevan kansainvälisen suojelun tarpeessa. Kaikkien tulijoiden voi olettaa jäävän Suomeen, joten jos viisumien jakelua ei rajoitettaisi minimiin, ongelmaksi tulisi esimerkiksi jo pelkästään Syyriassa miljoonat potentiaaliset hakijat. Koska viisumien jakelua olisi joka tapauksessa jo vastaanottokeskus- ja kuntapaikkojenkin vähyyden takia pakko rajoittaa korkeintaan muutamiin satoihin, on kiintiöpakolaisjärjestelmä hallitumpi keino pakolaisten vastaanottoon.

Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
Dublin-asetusta tuleekin muuttaa, jotta turvapaikanhakijoita ei enää palauteta maihin, joissa olot ovat heille huonot.

Tämä tarkoittaa käytännössä turvapaikkaoikeuden laajentamista sellaisiin maihin, joiden sosiaaliturvan katsotaan olevan suomalaisten normien alapuolella.

Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
Ilmastopakolaisille on myönnettävä kansainvälisesti virallinen asema, joka poliittista vainoa pakenevilla on.

Tämä tarkoittaa käytännössä turvapaikkaoikeuden laajentamista sellaisiin maihin, joiden katsotaan kärsivän ilmastonmuutoksesta. Oikea käytäntö on tietysti muuttaa oman maan sisällä uudelle alueelle.

Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
Pakolaisten perheenyhdistämisestä on tehty liian vaikeaa, mihin pitää tulla muutos.

Muutos pitäisi tulla siihen, että pakolaiset yhdistettäisiin pääsääntöisesti sinne, missä heidän perheensä on. Perheenyhdistämiskäytännöt ovat Suomessa Pohjoismaiden lepsuimmat. Suomi ei muista Pohjoismaista poiketen käytä lainkaan EU:n perheenyhdistämisdirektiivin mahdollistamia asunto-, toimeentulo- ja asuinaikaedellytyksiä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ike60 - 08.04.2015, 23:20:39
Lainaus käyttäjältä: Heidi Hautala ja Mervi Haakana
Pakolaisten ihmisoikeuksia ja heidän oikeuttaan turvapaikkaan on kunnioitettava. Ei voi olla niin, että heidän annetaan hukkua Välimereen.

Pakolaisten oikeuksiin ei kuulu saada turvapaikkaa haluamastaan maasta. Suojaa voidaan antaa myös EU:n ulkopuolella.

Millä keinoilla Vihreät estäisi ihmisiä hukkumasta Välimereen, etenkin kun tiedämme, että kaikki tulijat eivät suinkaan ole pakolaisia tai edes turvapaikanhakijoita?

Olen samaa mieltä: ei voi olla niin, että heidän annetaan hukkua Välimereen. Siksi onkin mietittävä keinoja joilla estää heidän hukkumisensa. Todettu on, että hukkuvien pelastaminen merestä vain lisää hukkumisia pitemmällä aikavälillä, koska se tekee ylityksestä itse asiassa turvallisempaa ja on siten yksi houkutustekijä Välimerta ylittäville. Todettu on, että nk. humanitaariset viisumit eivät ratkaise hukkumisongelmaa senkään vertaa, koska niitä ei käytännössä keretä jakaa kuin suhteellisen harvalle - tulijoiden virta joka tapauksessa paisuu niin suureksi kuin sallitaan, kun tulijoita (köyhyyttä pakenevia) on pari miljardia kappaletta.

Jää jäljelle vain yksi keino: vetovoimatekijöiden vähentäminen. Ja kun palkat, sossutuet jne. ovat täällä mitä ovat, ainoa keino on tehdä Välimeren ylitys niin kalliiksi että kenelläkään Välimeren eteläpuolella ei ole varaa siihen. Yksi keino on kerätä kaikki "pakolaisia" täynnä olevat romulaivat ja vihdoin tehdä niistä romurautaa. Paljon tehokkaampaa on, että palautetaan jokainen laivalla Välimerta ylittävä takaisin esim. Libyaan ja vasta sitten tehdään siitä laivasta romurautaa. Tällöin on olemassa todella iso riski että "pakolainen" joutuu maksamaan purjehduksensa kahteen kertaan (Libya -> laivalta poiminta -> Libya -> Italia) tai jopa useammin. Lipun hinta yksinkertaisesti nousee liian kalliiksi.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Phantasticum - 09.04.2015, 20:00:23
Mervi Haakana (http://mervihaakana.fi/?p=217)

Euroedustaja Heidi Hautalan ja eduskuntavaaliehdokas Mervi Haakanan kirjoitus on kyllä erinomainen näyttö täydellisen suhteellisuudentajun puutteen vaivaamasta ajattelusta. Heidän mukaansa ilmastopakolaisia arvellaan olevan vuoteen 2050 mennessä 50 miljoonasta miljardiin. Kun asian esittää hieman toisella tavalla, heidän mukaansa ilmastopakolaisia on arvelujen mukaan 50-1000 miljoonaa.

Jokainen lyhyenkin matematiikan oppimäärän suorittanut ymmärtää, millainen ero on 50 miljoonalla ja 1000 miljoonalla. Mutta ehkä vihreät eivät hahmota. Kunhan arvio on jotain sinne päin tai 20-kertainen. Ihan sama. He puhuvat siis aivan pokkana jopa 1000 miljoonan eli miljardin ihmisen uudelleen sijoittamisesta asumaan jonnekin muualle ja ilmeisesti tietenkin Eurooppaan, koska he antavat esimerkkinä Tanskan myöntämät oleskeluluvat.

Aikaa tämän toteutumiseen on varattu noin 35 vuotta. Todennäköisesti maailma näyttää 2050-luvulta sen verran toisenlaiselta, että Hautalan (s. 1955) ja Haakanan (s. 1970-1971) ei kannata olla huolissaan näissä eduskuntavaaleissa ilmastopakolaisuudesta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 10.04.2015, 03:14:21
Lainaus
Pakolaisvirta Kreikkaan kasvanut rajusti alkuvuonna

[...]

Ateenassa vieraillut EU:n siirtolaisasioiden komissaari Dimitris Avramopoulos sanoi EU:n olevan "huolestunut" nykyisestä turvapaikkajärjestelmästä. Hänen mukaansa EU "tietää muutoksen tarpeen" säännöstössä, jonka mukaan pakolaisista on huolehdittava siinä maassa, johon he saapuvat.

Se asettaa Avramopoulosin mukaan kohtuuttoman taakan EU:n eteläisille valtioille Kreikalle ja Italialle, joihin ihmissalakuljetus suuntautuu.
Yle (http://yle.fi/uutiset/pakolaisvirta_kreikkaan_kasvanut_rajusti_alkuvuonna/7919482) 10.4.2015

EU:n maahanmuuttokomissaari yrittää keksiä tekosyitä turvapaikanhakijoiden pakkosiirtoihin jäsenmaiden kesken, mutta huonolla menestyksellä.

Sekä Kreikan että Italian "kohtuuton taakka" oli viime vuonna väkilukuun suhteutettuna pienempi kuin EU:ssa keskimäärin (http://ec.europa.eu/eurostat/documents/2995521/6751779/3-20032015-BP-EN.pdf/35e04263-2db5-4e75-b3d3-6b086b23ef2b). Italian edellä oli 11 EU-maata (sekä myös Norja, Sveitsi ja Liechtenstein) ja Kreikan edellä Italia mukaan lukien 13 EU-maata 28:sta. Kuormitetuimmat maat eivät suinkaan löydy etelästä vaan Keski- ja Pohjois-Euroopasta.

Kaiken lisäksi suojan tarjoamiseen velvoitetun maan määrittämiseen käytettyä Dublin-sopimusta ei enää sovelleta Kreikkaan ja Italiaankin vain rajoitetusti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 10.04.2015, 03:33:29
^

Komissaari Avramopoulos (http://en.wikipedia.org/wiki/Dimitris_Avramopoulos) piiskaa vimmatusti Eurostoliiton pakolaistaakanjakoa laukkaan, mikä ei sinänsä ole yllätys. Kreikastahan hän itsekin on kotoisin.

(http://www.thetoc.gr/images/eng/articles/0/article_5160/illegal-immigration-from-turkey-up-by-140.w_l.jpg)
Koneinsinöörejä matkalla Eurostoliittoon

Omituiselta sen sijaan tuntuu se, että kun meillä näistä vainotuista pakolaisista puhutaan rikkautena ja vaippojen vaihtajina, pidetään heitä eteläisissä eurostotasavalloissa taakkana! Mitenkä nyt noin?

Joka tapauksessa käyrät osoittavat nyt vahvasti koilliseen, joten olisiko viimein aika pohtia, mikä tilanteessa on realistista ja mikä ei? Mekaniikka, jossa kaikenlaiset taakat siirtyvät etelästä pohjoiseen ja rahat päinvastoin, on enää viimeistä silausta vaille toiminnassa.

Uskooko joku, että CEAS -sopimuksen voimaantulo voidaan estää, kun oma pääministerimmekin on sitä ollut ajamassa? Mallihan etenee kuin höyryveturi, eikä vaalikeskusteluissa puhua pukahdeta koko asiasta. Onko meille saneltu jotain asian suhteen?

Eurostoliiton ulkorajojen valvontahanke, jonka budjetista rakennetaan nyt valvontatorneja Puolan ja Kaliningradin väliselle rajalle, on pelkkä vitsi. Lukutaidotonta tulee ovista ja ikkunoista, mutta kenelläkään ei tule edes mieleen, että näitä voisi palauttaa lähtömaihinsa.

Minusta meidän ei pitäisi olla noissa päättävissä pöydissä edes keskustelemassa asiasta, mutta se ei ole kuulemma realismia. Toivoa sopiikin, että korttitalon romahdus alkaisi mahdollisimman pian jostain muualta, jotta vahingot jäisivät Suomen osalta mahdollisimman vähäisiksi.

Edit: Roope ehti jo linkata uutisen
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Timo Rainela - 16.04.2015, 12:48:50
Jussi Halla-aho facebook / 16.4.2015


Tällä viikolla LIBE käsitteli Dublin-asetuksen (Dublin III) muuttamista "ilman saattajaa tulleita alaikäisiä turvapaikanhakijoita" koskevan pykälän osalta.

Dublin-menettelyn keskeinen periaate on, että turvapaikkahakemus on jätettävä ensimmäiseen turvalliseen maahan, ja että vastuu turvapaikkahakemuksen käsittelystä kuuluu kyseiselle jäsenmaalle.

Tämä periaate vesitettiin Dublin III -vaiheessa, koska EU-tuomioistuin ja Euroopan Ihmisoikeustuomioistuin kielsivät palauttamasta turvapaikanhakijaa sellaiseen jäsenmaahan, jonka vastaanotto-oloissa on systemaattisia puutteita. Käytännössä tämä tarkoittaa sitä, että Kreikkaan ei voida palauttaa ketään.

Uusimman revision sisältö on se, että se maa, jossa alaikäinen turvapaikanhakija (käytännössä ja tosiasiallisesti 17-25-vuotias mies) on läsnä, on velvollinen prosessoimaan hakemuksen (ja näin ollen myös myöhemmän perheenyhdistämishakemuksen), vaikka hakija olisi tullut turvallisen maan (kuten Italian) kautta, ja vaikka hän olisi jättänyt muualle aiempia hakemuksia ja saanut niihin kielteisen päätöksen. Jokseenkin järjettömänä perusteluna on se, että alaikäisten siirto jäsenmaiden välillä on traumatisoiva kokemus.

Muutos avaa lisää mahdollisuuksia turvapaikka- ja perheenyhdistämisshoppailulle. Alaikäinen hakija voi vapaasti valita jäsenmaan, johon hän perheineen haluaa asettua. Alaikäisiä EU-alueella kuskaavat rikollisorganisaatiot tekevät lisää tiliä.

Dublin-menettelyä (josta sinänsä voidaan olla monta mieltä) revitään systemaattisesti ja pala kerrallaan rikki. Ilmeisesti tarkoituksena on tehdä houkuttelevimpien jäsenmaiden (Saksa, Ruotsi, Hollanti) tilanne niin kestämättömäksi, että ne saadaan tukemaan ja ajamaan sitovaa taakanjakomekanismia.

Asian käsittely alkaa ajassa 1:09. Oma puheenvuoroni on ajassa 1:58:55.

http://www.europarl.europa.eu/news/en/news-room/content/20150409IPR41028/html/Committee-on-Civil-Liberties-Justice-and-Home-Affairs-meeting-13.04.2015
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 16.04.2015, 13:09:27
Jussi Halla-aho facebook / 16.4.2015
...
Dublin-menettelyä (josta sinänsä voidaan olla monta mieltä) revitään systemaattisesti ja pala kerrallaan rikki. Ilmeisesti tarkoituksena on tehdä houkuttelevimpien jäsenmaiden (Saksa, Ruotsi, Hollanti) tilanne niin kestämättömäksi, että ne saadaan tukemaan ja ajamaan sitovaa taakanjakomekanismia.

Juuri tästä on ollut kyse jo ainakin viimeiset kuusi vuotta. Kun Dublin-menettely murenee, palataan taas turvapaikkashoppailun aikaan. Tällä kertaa ongelmaa ei kuitenkaan ratkaista Dublin-sopimuksella kuten aiemmin, vaan "pakollisella solidaarisuudella" eli turvapaikanhakijoiden jakamisella EU-maiden kesken.

Toukokuussa julkistetaan EU:n alustavat linjaukset.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Uuno Nuivanen - 16.04.2015, 13:13:51
No Ruotsihan on selvä tapaus, mutta ovatko Saksa ja Hollantikin niin tukevasti kukkahattujen kynsissä, että suostuvat moiseen?  :-\
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Raaka banaani - 16.04.2015, 13:19:41
Lainaus
Tanska, ensimmäisenä Euroopan maana, on jo myöntänyt ilmastopakolaisille oleskelulupia.

Onko oikeasti? Eikö Tanskassa pitänyt olla tolkuissaan oleva hallitus?

Googgeloin ja ainakin 2009 näin on vielä ollut:
Lainaus
Tanska on ainoa Euroopan maa, joka ottaa vastaan ilmastopakolaisia. Useat Afganistanista ja Itä-Afrikasta lähteneet ihmiset ovat saaneet Tanskassa oleskeluluvan nimenomaan kotimaansa äärimmäisten ilmasto-olosuhteiden takia, kirjoittaa tanskalainen sanomalehti Berlingske Tidende.
http://yle.fi/uutiset/tanska_ottaa_vastaan_ilmastopakolaisia/5971230
:o   :'(
Suomessa on myös äärimmäiset ilmasto-olosuhteet. Minne me päästäisiin?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 19.04.2015, 17:10:14
Lainaus
EU-ulkoministeri pakolaisaallosta: Etelä-Eurooppa ei voi olla yksin vastuussa

EU:n ulko-ja turvallisuuspolitiikan korkea edustaja Federica Mogherini vaatii vastuun jakamista Pohjois-Afrikan pakolaisaallosta.

Federica Mogherinin mukaan se, mitä tapahtui lauantain ja sunnuntain välisenä yönä, ei voi hyväksyä. Pakolaisaluksen kaatumisessa menehtyi ilmeisesti noin 700 ihmistä.

Hänen mukaansa unionin on tartuttava toimeen viivytyksettä vastaavien tragedioiden välttämiseksi.

Mogherini vaatii, että vastuuta jaetaan kaikkien 28 EU-jäsenmaan kesken.

- Vastuu on liian kauan ollut pelkästään Etelä-Euroopan mailla, hän sanoo tiedotteessaan.
Verkkouutiset (http://www.verkkouutiset.fi/ulkomaat/mogherini_pakolaiset-34912) 19.4.2015

Kertaus:

Lainaus
Ateenassa vieraillut EU:n siirtolaisasioiden komissaari Dimitris Avramopoulos sanoi EU:n olevan "huolestunut" nykyisestä turvapaikkajärjestelmästä. Hänen mukaansa EU "tietää muutoksen tarpeen" säännöstössä, jonka mukaan pakolaisista on huolehdittava siinä maassa, johon he saapuvat.

Se asettaa Avramopoulosin mukaan kohtuuttoman taakan EU:n eteläisille valtioille Kreikalle ja Italialle, joihin ihmissalakuljetus suuntautuu.
Yle (http://yle.fi/uutiset/pakolaisvirta_kreikkaan_kasvanut_rajusti_alkuvuonna/7919482) 10.4.2015

EU:n maahanmuuttokomissaari yrittää keksiä tekosyitä turvapaikanhakijoiden pakkosiirtoihin jäsenmaiden kesken, mutta huonolla menestyksellä.

Sekä Kreikan että Italian "kohtuuton taakka" oli viime vuonna väkilukuun suhteutettuna pienempi kuin EU:ssa keskimäärin (http://ec.europa.eu/eurostat/documents/2995521/6751779/3-20032015-BP-EN.pdf/35e04263-2db5-4e75-b3d3-6b086b23ef2b). Italian edellä oli 11 EU-maata (sekä myös Norja, Sveitsi ja Liechtenstein) ja Kreikan edellä Italia mukaan lukien 13 EU-maata 28:sta. Kuormitetuimmat maat eivät suinkaan löydy etelästä vaan Keski- ja Pohjois-Euroopasta.

Kaiken lisäksi suojan tarjoamiseen velvoitetun maan määrittämiseen käytettyä Dublin-sopimusta ei enää sovelleta Kreikkaan ja Italiaankin vain rajoitetusti.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Golimar - 19.04.2015, 17:26:55
Lainaus
Mogherini vaatii, että vastuuta jaetaan kaikkien 28 EU-jäsenmaan kesken.

- Vastuu on liian kauan ollut pelkästään Etelä-Euroopan mailla, hän sanoo tiedotteessaan.

Jos kerran haalivat gutaleita niin pitäkööt ne.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaakko Sivonen - 20.04.2015, 22:16:39
Lainaus
EU-ulkoministeri pakolaisaallosta: Etelä-Eurooppa ei voi olla yksin vastuussa

[...] Mogherini vaatii, että vastuuta jaetaan kaikkien 28 EU-jäsenmaan kesken.

- Vastuu on liian kauan ollut pelkästään Etelä-Euroopan mailla, hän sanoo tiedotteessaan.
Verkkouutiset (http://www.verkkouutiset.fi/ulkomaat/mogherini_pakolaiset-34912) 19.4.2015

Ja tänään Erkki Tuomioja puhui myönteisesti EU-maiden "yhteisöllisyydestä" tähän liittyen... Ja silti Päivi Räsänen kehtasi viime viikon vaaliväittelyssä valehdella väittäen, että "kukaan" ei ole edistämässä taakanjakoa.

Perussuomalaisten tulee hallitusneuvotteluissa vastustaa taakanjakoa. Se on yksi tärkeimmistä kysymyksistä tällä hetkellä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Iloveallpeople - 23.04.2015, 13:58:50
Lainaus
Jussi halla-aho

Terveisiä Libestä, jossa keskustellaan taas taakanjaosta ja Välimerestä. Komission edustaja kertoo juuri, että paateissa on yhä vähemmän pakolaisia Syyriasta ja Eritreasta ja yhä enemmän elintasosiirtolaisia Länsi-Afrikasta.

Eurooppa-neuvosto kokoontuu tänään illalla, ja sen odotetaan tekevän konkreettisen esityksen "jakoavaimesta" (distribution key), eli kriteereistä, joiden mukaan tulijoita ryhdyttäisiin jakamaan "reilusti" jäsenmaiden kesken.

Valiokunnan demarit ja vasemmisto vaativat *kiimaisesti* laillisten reittien avaamista Eurooppaan, huutelevat väliin ja loukkaantuvat siitä, että komissio kutsuu länsiafrikkalaisia elintasosiirtolaisiksi.

Salakuljetuspalveluja mainostetaan täysin avoimesti mm. sosiaalisessa mediassa. Kuvaavaa on, että hinnastoissa on myös palvelu nimeltä "smuggling from Greece to Europe".

Facebook (https://www.facebook.com/jussi.hallaaho/posts/764776700309193?comment_id=764785776974952&ref=notif&notif_t=like)

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: kriittinen_ajattelija - 29.04.2015, 22:28:19
(https://scontent-cdg.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/11183356_788123997924036_6535180443588096750_n.jpg?oh=de896253d58e65230806fcb482b2a074&oe=5597BC39)
hmhm?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Green - 29.04.2015, 23:12:00
Tämä on ehkäpä tärkein asia, joka EU:ssa on ratkaistavana lähivuosina. Tietääkö joku, miten eri ryhmät äänestivät ja ennen kaikkea, miten suomalaismepit äänestivät? MTV:n uutisissa Sarvamaa (kok) jo kertoi äänestäneensä puolesta ja Halla-aho (ps) vastaan. Olisi myös mukava tietää päätöksen tarkka sanamuoto.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: MW - 29.04.2015, 23:38:53
Tämä on ehkäpä tärkein asia, joka EU:ssa on ratkaistavana lähivuosina. Tietääkö joku, miten eri ryhmät äänestivät ja ennen kaikkea, miten suomalaismepit äänestivät? MTV:n uutisissa Sarvamaa (kok) jo kertoi äänestäneensä puolesta ja Halla-aho (ps) vastaan. Olisi myös mukava tietää päätöksen tarkka sanamuoto.

Hajaantukaa, epäuskoiset. Juurihan tuossa vaalien alla Päivi Räsänen sanoi, ettei moista himmeliä ole. Ja Päivillä on moraali. Tai oli.

Paljonkohan maksoivat.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: TheJ - 29.04.2015, 23:40:19
Jos Italia ja kumppanit eivät osaa valvoa ulkorajaansa ja kääntää merikelvottomia paatteja takaisin lähtösatamaan niin sitten kärsikööt. Ei hitto niin että heidän rajavalvonnan munattomuuden vuoksi tänne läjäpäin uusia elättejä "taakanjaon" nimissä.

Sitäpaitsi mikä hiton taakanjako, eikös näiden pitänyt olla rikkaus ja voimavara? Saisko tästä rikkauden tulvasta jäädä ulkopuolelle?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 29.04.2015, 23:51:14
Mikäli Suomi vastustaa tätä sopimusta, olisi korkea aika kertoa se julkisuuteen. Asiat etenevät aika liukkaasti nyt.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaakko Sivonen - 29.04.2015, 23:59:37
Tuossa taisi olla kyse vasta parlamentin julkilausumasta. Eikä ole ilmeisesti ensimmäinen kerta:

Lainaus
Euroopan parlamentti on useaan otteeseen, viimeksi vuonna 2014, vaatinut pysyvän ja sitovan taakanjakomekanismin luomista.
http://www.halla-aho.com/scripta/taakanjakoa_ja_numeroita.html

Tarvittaisiin käsittääkseni Eurooppa-neuvoston päätös, että tuo tulisi voimaan? Viime viikolla neuvosto oli vielä keskittynyt valvonnan tiukentamiseen, ei niinkään taakanjakoon.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Taffu - 30.04.2015, 00:04:05
Olipahan homma kaivaa kyseinen ehdotelma netistä, tulin jo vainoharhaiseksi ja luulin että tarkoituksella piilotettu :)

http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-%2f%2fEP%2f%2fTEXT%2bMOTION%2bB8-2015-0384%2b0%2bDOC%2bXML%2bV0%2f%2fEN&language=EN

Lainaus
6.      Deplores the fact that the European Council failed to set up a credible EU-wide binding mechanism for solidarity which would encompass a compulsory resettlement scheme along with emergency relocations between Member States. In this context, it is essential to proceed to revise the Dublin III Regulation and create a fair distribution quota between the Member States, based on GDP, size and population, unemployment rates, the number of refugees already present and, to a certain extent, their personal choices ; urges the Member States, in the meantime, to fully use the criteria provided for in the Dublin III Regulation, such as the unaccompanied children, family reunification and discretionary clauses;

7.      Calls for a rapid and full transposition and effective implementation of the Common European Asylum System by all participating Member States, thereby ensuring common European standards under existing legislation;

Tuossapa tuo oleellisin, myöhemmin toki todetaan myös, että turvapaikka on ihmisoikeus.

Miten tämä nyt tuosta etenee? Ilmeisesti menee vielä johonkin prosesseihin ennen hyväksyntää, ja jos ja kun tuo hyväksytään, niin onko Suomella mitään mahdollisuutta omalla lainsäädännöllä enää torpata tuota hulluutta?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.04.2015, 00:12:39
Maikkarin Seitsemän uutisissa oli lyhyt juttu otsikolla "EU vaatii maakiintiöitä pakolaisille", mutta nettisivuilla ei ole europarlamentin hyväksymästä päätöslauselmasta sanaakaan, ei myöskään muissa valtamedioissa.

Ainoastaan Vihreä Lanka raportoi (http://www.vihrealanka.fi/uutiset-ulkomaat/euroopan-parlamentti-pysyv%C3%A4-pelastusoperaatio-v%C3%A4limerelle) parlamentin päätöslauselmasta, mutta jutussa ei mainita jäsenmaita sitovia turvapaikanhakijakiintiöitä, vaan ruikutetaan, ettei parlamentti vaatinut humanitaarisen viisumin käyttöönottoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: FadeAway - 30.04.2015, 00:24:29
^Katsoin noi mtv3 uutiset. Ihmettelin, nytkö tämä on jo päätetty?
Vai onko kyseessä käsittely tai joku erillinen vaatimus.
Jos pitää paikkaansa. Suomen ruotsittuminen alkaa todenteolla, eikä Suomi voi itse vaikuttaa päätöksiin(n. 1% äänivallasta). Seuraavalle hallitukselle tulee tiukka paikka selitellä maahanmuuton tuplaantumista ja laadun huonontumista 5x !!
Kustannuksista on turha puhua. 700mx???

Suomen media on kyllä toivotonta. Ei mitään EU-asioita seurata tai ainakaan uutisoida.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: PaulR - 30.04.2015, 00:25:59
[,,,]Hautalan (s. 1955) ja Haakanan (s. 1970-1971) ei kannata olla huolissaan näissä eduskuntavaaleissa ilmastopakolaisuudesta.[...]

Harmittaa olla niin kyyninen, mutta tuossa se luultavasti oli. Farage puhui juuri muutaman sanan asiasta EU:ssa. [29.4.2015]
 
https://www.youtube.com/watch?v=NTwOap7ohc4 (https://www.youtube.com/watch?v=NTwOap7ohc4)

Hyvä kuitti alankomaiden vihreiden kysymykseen vastauksen lopuksi. State sponsored multiculturalism... fifth column.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Skeptikko - 30.04.2015, 00:31:42
Olipahan homma kaivaa kyseinen ehdotelma netistä, tulin jo vainoharhaiseksi ja luulin että tarkoituksella piilotettu :)

http://www.europarl.europa.eu/sides/getDoc.do?pubRef=-%2f%2fEP%2f%2fTEXT%2bMOTION%2bB8-2015-0384%2b0%2bDOC%2bXML%2bV0%2f%2fEN&language=EN

Jos tulkitsen oikein näitä dokumentteja, niin tämä ehdotus korvaa tuon:

http://www.europarl.europa.eu/sides/getDoc.do?type=MOTION&reference=P8-RC-2015-0367&language=EN

Tähän liittyy ilmeisesti tämän säännöstön sääntö numero 123:

http://www.europarl.europa.eu/sipade/rulesleg8/Rulesleg8.EN.pdf

Tosin onko tuokaan korvaava lopullisesti äänestyksessä hyväksytty versio, niin se on eri asia...

Oletan, että tämä uutinen käsittelee samaa asiaa, vaikken tiedä miten luotettavia eri uutislähteiden raportoinnit asiasta ovat:

http://www.bbc.com/news/world-europe-32516497
Migrant crisis: European Parliament calls for bolder action

...
The resolution, which is non-binding and has no legal force, says all EU countries should be required to accept a certain number of asylum seekers.
...
The resolution adopted on Wednesday asks the European Commission to establish "a binding quota for the distribution of asylum seekers amongst all Member States".
The issue is controversial. At a EU summit last week, no agreement was reached between EU countries on a common asylum system or quotas for northern European countries.
The UK has said it would provide naval support, but would not accept more asylum seekers.
...

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: FadeAway - 30.04.2015, 00:32:17
Suomen hallituksen tulee vastata. "EU vaatii maakiintiöitä pakolaisille"
Suomella on kiintiöpakolaismäärä 750, jos pakolaisia mahtuu siihen, niin saatamme harkita vastaanottamista, mutta kiintiötä enempää emme ole valmiita vastaanottamaan.
Ainakaan ennen kuin kaikki muut EU-maat kantavat oman taakkansa. Sen jälkeen Suomen eduskunta harkitsee asiaa uudelleen.
Minimivaatimuksena on riittävä korvaus vastaanottamisesta ja jatkosijoitusmahdollisuus. Suomi on eräs EU:n kalliimpia maita, joten sijoittaminen on järkeväämpää halvempiin maihin, jotka eivät ota paljoa maahanmuuttajia/vuosi.
Myös nykyinen ehdotus taakanjakomekanismin laskentaperusteista on virheellinen. Suomi ei voi 10-kertaistaa pakolaisten&turvapaikanhakijoiden määrää, joten Suomi ei osallistu nykyiseen ehdotukseen.

EU:n myös pitää sopia keskimääräinen korvaus/pakolainen, jotta maiden välillä shoppailu loppuu. Suomi ei ota vastaan toisessa EU-maassa kiintiöpaikan saaneita pakolaisia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.04.2015, 00:37:13
MTV3:n Kymmenen uutiset:
Lainaus käyttäjältä: MTV3 29.4.2015
Toimittaja Helena Petäistö
EU-komission puheenjohtaja vaati pikaista toimintaa, ennen kuin yleinen mielipide ehtii muuttua.

Jean-Claude Juncker, EU-komission puheenjohtaja
Meidän täytyy toteuttaa pakolaisten jakaminen maantieteellisesti koko Euroopan alueelle.

Toimittaja Helena Petäistö
Taakanjaosta käytiin salissa jopa maaottelu.

Cecilia Wikström, Ruotsin EU-kansanedustaja [puheenvuoro salissa]
Nykyään 15 maata ottaa vastaan pakolaisia ja muut pyyhkivät kätensä. [Wikström pyyhkii suurin elein käsiään ja hänen äänensä murtuu] Se on järkyttävää!

Jussi Halla-aho, EU-kansanedustaja. [puheenvuoro salissa]
Euroopalla ei ole taloudellisesti, sosiaalisesti eikä poliittisesti varaa tällaiseen maahanmuuttoon.

Liisa Jaakonsaari, EU-kansanedustaja
Pakolaisten vastaanottamisen suhteen Suomi on kyllä aikamoinen syrjästä katsoja. Suomi kuuluu niiden maiden joukkoon, joilta odotetaan nyt enemmän.

Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaakko Sivonen - 30.04.2015, 00:44:14
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Syyrian ja Somalian todellisuudesta tulee Euroopan tulevaisuutta, jos tämä taakanjakomekanismi tulee käyttöön.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: PaulR - 30.04.2015, 00:51:13
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Syyrian ja Somalian todellisuudesta tulee Euroopan tulevaisuutta, jos tämä taakanjakomekanismi tulee käyttöön.

Tuon edellä mainitun 'itse en ole onneksi sitä näkemässä' -jutun kanssa uskon sukupolvikysymykseen, jossa suurilla ikäluokilla on yksinkertaisesti kyvyttömyyttä nähdä sellainen maailma.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaakko Sivonen - 30.04.2015, 00:58:17
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Syyrian ja Somalian todellisuudesta tulee Euroopan tulevaisuutta, jos tämä taakanjakomekanismi tulee käyttöön.

Tuon edellä mainitun 'itse en ole onneksi sitä näkemässä' -jutun kanssa uskon sukupolvikysymykseen, jossa suurilla ikäluokilla on yksinkertaisesti kyvyttömyyttä nähdä sellainen maailma.

Niin, Antti Rinnehän sanoi suoraan, että hän ei välitä pätkääkään siitä, millainen maa Suomi on sitten, kun hän on itse kuollut:

Lainaus käyttäjältä: Antti Rinne
Hölmöä miettiä, mikä maan tai maapallon tila on 100 vuoden kuluttua, eihän meistä kumpikaan ole silloin enää elossa
http://alueviesti.fi/2015/04/10/rinne-sastamalassa-ministerion-virkamiehet-eivat-sanele-politiikan-suuntaa/

SDP:tä ei kiinnosta se, jos Suomi on sadan vuoden päästä yksi suuri Rinkeby, kunhan ammattiliittojen etuuksiin ei kosketa ensi vuonna. Sama juttu kokoomuksen ja ensi vuoden veronalennusten kanssa. Sama juttu kepun ja ensi vuoden maataloustukiaisten kanssa. Harvassa on se poliitikko, joka on aidosti kiinnostunut koko kansakunnan tulevaisuudesta.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Golimar - 30.04.2015, 01:04:48
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Petri Sarvamaa voisi olla eri mieltä jos todellisuus tulee vastaan nyrkit pystyssä kuten monelle suomalaiselle tai paljon useamalle muulle eurooppalaiselle on käynyt, hyvähän se on siellä norsunluutornissa suuta aukoa.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: kriittinen_ajattelija - 30.04.2015, 01:08:24
Lainaus
Juncker calls for EU refugee quotas, legal migration to Europe
The European Commission's president has called for refugee quotas for EU countries and more legal migration. Europe's leaders are discussing ways to stop thousands of migrants dying in attempts to reach the continent.

Speaking to lawmakers at the European Parliament in Strasbourg on Wednesday, European Commission President Jean-Claude Juncker suggested a binding quota for taking in refugees across all 28 EU member countries.
"I will appeal… for the establishment of a quota system," Juncker said, outlining plans he would later present to the rest of the European Commission. "We must distribute refugees throughout the whole of Europe."
Currently, only five EU countries, including Germany, take in 75 percent of the refugees in the bloc.
Wednesday's debate follows widespread concern in Europe about the deaths of thousands of migrants from Africa, Asia and the Middle East trying - via dangerous journeys often at the hands of human traffickers - to reach the bloc due to persecution, conflict or poverty. In response to mass-drownings off the coast of Libya, EU leaders last week announced a boost the Triton patrol mission in the Mediterranean.

Legal migration
"In the medium term, legal migration must be on the agenda," Juncker said, calling on member states to take in not just people needing protection, but also a limited number of people wanting to come to Europe and seek work.
"If we don't open the door, even partly, you can't act surprised when the unfortunate from across the planet break in through the window," he said.
He said while everyone knew that Europe could not be the only place of refuge in the fight against poverty, as the richest continent it must help so that people, driven by need, did not end up "sitting in boats and drowning before our coasts."
Juncker criticized the response of EU governments to the latest tragedies as "inadequate."
"It's not enough to just fight the symptoms of this crisis," he said, adding that "Member states must extend development aid, that's absolutely necessary."
The commission - the EU's executive arm - is due to unveil a comprehensive migration strategy in mid-May.
se/sms (dpa, AFP, epd, Reuters)
http://www.dw.de/juncker-calls-for-eu-refugee-quotas-legal-migration-to-europe/a-18417014

(https://scontent-cdg.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/11183356_788123997924036_6535180443588096750_n.jpg?oh=de896253d58e65230806fcb482b2a074&oe=5597BC39)
Ne äänesti tästä siellä jotenkin?

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Ari-Lee - 30.04.2015, 01:38:26
Jos tällainen taakanjako rikkaudesta & voimavarasta tulee Baltian maihin niin kuinka he reagoivat? Onko heillä tälläkään hetkellä varaa edes omaan sosiaaliturvaan, saati elättämään vielä afrikkalaisia ja lähi-itäläisiä?

Uskon, että kaikesta €U -mesoomisesta ja äänestelystä huolimatta päätös jää kansallisvaltion omalle kontolle kuten tähänkin asti. Varatontahan ei voi velvoittaa kenenkään ulkopuolelta tulijan elatukseen. En kanna mitään vastuuta kenestäkään enkä kenenkään tekemisistä.

Jos kaikesta huolimatta tällainen kaamea luonnonilmiö kohtaisi, niin meidän taikaseinä kaatuisi ensimmäisenä. Sitten kaatuisi yhteiskuntarauha. Se olisi koko tähän asti tuntemamme Suomen loppu ja siitä alkaisi uusi sekasortokausi. Koko Suomen talous on tälläkin hetkellä niin kuralla, kuin vain voi olla. Remonttia kaipaavat niin puolustusvoimat; ilmavoimien kalusto, merivoimien kalusto, rajavartiolaitos, poliisi, tulli, Suomen tiestö, jne. jne. Verojen korotusten tie on loppuun tallattu, rahaa ei ole, kirstu on tyhjä.

Ja Kaldoaivin erämaa kutsuu...
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Peltipaita - 30.04.2015, 02:28:54
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Vaalipuheet on vaalipuheita, hmm. Laajempi käsitys demokratiasta.

Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Skeptikko - 30.04.2015, 02:33:00
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Vaalipuheet on vaalipuheita, hmm. Laajempi käsitys demokratiasta.

Eivätkö nämä massamaahanmuuttoa ajavat tiedä tai ymmärrä millaista tuhoa he ovat tekemässä vähänkin pidemmällä aikavälillä tarkasteltuna vai eivätkö he yksinkertaisesti piittaa asiasta?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.04.2015, 02:36:29
Vaalipuheet on vaalipuheita, hmm. Laajempi käsitys demokratiasta.

Sievempi käsitys takinkäännöstä. Sarvamaa on vaalipuheissaan ilmoittanut kannattavansa kansallista maahanmuuttopolitiikkaa, mutta nyt hän kohtasi Brysselissä todellisuuden, joka vaatii kansallisen päätöksenteon jyräämistä.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: leo3 - 30.04.2015, 03:31:58
Lainaus käyttäjältä: Petri Sarvamaa, EU-kansanedustaja
Minä äänestin tuon taakanjaon puolesta. Et se on vähän sillä tavalla, että vaalipuheet on vaalipuheita, ja todellisuus maailmassa on sitten toista. Ja nyt meidän täytyy kohdata tää todellisuus.

Wikipediasta: (http://fi.wikipedia.org/wiki/Petri_Sarvamaa)

Lainaus
Sarvamaan isä Boris Saharov syntyi vuonna 1908 Pietarissa ja muutti Venäjän vallankumouksen aikaan Terijoen kautta Joensuuhun. Perhe otti vuonna 1930 sukunimekseen Sarvamaan.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: ile - 30.04.2015, 04:29:06
Sarvamaa pääsi jo Youtubeen: https://www.youtube.com/watch?v=UBprIpqviZ8
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Peltipaita - 30.04.2015, 04:41:51
Vaalipuheet on vaalipuheita, hmm. Laajempi käsitys demokratiasta.

Sievempi käsitys takinkäännöstä. Sarvamaa on vaalipuheissaan ilmoittanut kannattavansa kansallista maahanmuuttopolitiikkaa, mutta nyt hän kohtasi Brysselissä todellisuuden, joka vaatii kansallisen päätöksenteon jyräämistä.

Demokratiaa ei ole jos äänestäjä ei voi luottaa ehdokkaan aikomuksiin suhteessa puheisiin ja tekoihin. Takinkääntö on turhan vähättelevä ilmaisu tällaisesta toiminnasta. Brysselissä voidaan vaatia, mutta ehdokas tehköön sitä mitä on luvannutkin. Tuollaisesta toiminnasta pitäisi joutua oikeuteen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Jaska Pankkaaja - 30.04.2015, 06:27:09
Kun "taakanjako" alkaa on se vuosi 0 Suomalian historiassa. Tämän jälkeen jokainen "vastuullinen poliitikko" ja virkaloinen on vain ja ainoastaan kansan vihollinen.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Micke90 - 30.04.2015, 06:34:12
Sarvamaa pääsi jo Youtubeen: https://www.youtube.com/watch?v=UBprIpqviZ8

Meni loppukin uskottavuus Kokkareiden "maahanmuuttokritiikiltä".
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Riukulehto - 30.04.2015, 06:38:53
Sarvamaahan meni itsellä luotto jo parisen vuotta sitten, kun herra oli Leijonan Luola ohjelmassa tukemassa Zimbabwelaista Julia Wilsonia. Linkissä klippi kyseisestä ohjelmasta. http://www.ruutu.fi/ohjelmat/leijonan-luola/euroedustaja-tukemassa-outoa-bisnesideaa-taa-on-dynamiittia
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Riukulehto - 30.04.2015, 12:18:52
Sarvamaa facebookissa:
Lainaus
"Vaalipuheet on vaalipuheita" -lausuntoni Kympin uutisissa viittaa tietenkin PS:n vaalipuheisiin - ei Petri Sarvamaan
  :facepalm:
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Kemolitor - 30.04.2015, 12:41:24
Riikka Purralta uusi kirjoitus:
Riikka Purra: Taakanjako ja moraali (http://riikkapurra.net/2015/04/29/taakanjako-ja-moraali/)

Suositan, hyvää ja selkeätä tekstiä.

Taakanjako-termiä tässä yleisemmin pyörittelin mielessäni. Se on niitä asioita, joiden kohdalla ihmettelen maailmanpelastajien ja maahanmuuttomaanikoiden uskomatonta henkistä kapasiteettia pystyä kääntämään asiat sujuvasti päässään ääripäästä toiseen ilman minkäänlaisia ristiriitoja.

Toisaalta meille kerrotaan, miten humanitääriset maahanmuuttajat luovat maahan työllisyyttä (tarjolla olevan työvoiman lisäys luo lisää työpaikkkoja), perustavat yrityksiä, pelastavat maan työvoimapulalta, hoitavat meidät sitten eläkkeellä ollessamme, rikastuttavat ankeata monokulttuuriamme, parantavat suomalaisten geeniperimää, luovat maahan monikulttuurisuutta, jonka arvon mittaamiseen ei minkään mittarin asteikko riitä jne.

Toisaalta sitten samat ihmiset pystyvät puhumaan taakanjaosta, kuinka Suomenkin moraalinen ja eettinen ja ties mikä velvollisuus on kantaa osansa tästä taakasta, joka Euroopan osalle on langennut.

Tämä ei siis liittynyt suoraan Riikka Purran kirjoitukseen, hän kirjoittaa järkeviä ajatuksia.
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: svobo - 30.04.2015, 12:53:54
Äärialtruisti pitää huolen myös itsestään, jotta kykenee auttamaan jatkossakin. Joku humanitäärinen viisumi miljoonille afrikkalaisille johtaa Eurooppalaisen sivilisaation romahdukseen. Kuka sitten auttaa afrkkalaisia (ja eurooppalaisia)?
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: xor_rox - 30.04.2015, 12:56:31
Nyt meidän täytyy kohdata tää todellisuus.
 - Petri Sarvamaa

(http://hommaforum.org/index.php?action=dlattach;topic=58569.0;attach=42219;image)
Otsikko: Vs: EU:n yhteinen pakolaispolitiikka (CEAS) voimaan jo 2012... missä mennään???
Kirjoitti: Roope - 30.04.2015, 13:00:42
Juncker vaatii, ja myös Merkel vaatii.

Lainaus
Germany presses for quota system for EU migrant distribution

Germany has thrown its weight behind long-stalled efforts to revamp Europe’s dealings with refugees, demanding a quota system that would distribute migrants coming to Europe more equitably among the 28 countries of the European Union.

The hugely divisive policy shift has been spurred by the emergency in the Mediterranean and the longer-term likelihood of hundreds of thousands of migrants washing up on Europe’s southern shores annually. Berlin is pushing for a more equal system of bearing the refugee burden.

National interest, as well as greater fairness, is driving Chancellor Angela Merkel’s policy. Last year, Germany fielded about one-third of the 626,000 claims for asylum in the EU, according to European commission figures. Proportionate to population, this was less than Sweden, but in numbers far more than anywhere else in Europe.

Immigration policy and migrants’ admissions are entirely in the hands of national governments, with minimal powers enjoyed by Brussels. But Merkel won strong support on Wednesday from Jean-Claude Juncker, the president of the European commission, which is to table new immigration proposals in a fortnight. Juncker signalled that the new plans could include a distribution key for spreading successful asylum applicants around Europe.

But Donald Tusk, the president of the European council who organises and chairs summits of EU national leaders, acknowledged that the debate on refugee-sharing would be “difficult and sensitive”.

Tusk chaired an emergency summit in Brussels last week in response to the drowning of 800 migrants in the Mediterranean and amid a clamour for Europe to be doing more to prevent the tragedies.

While the leaders came up with money and assets to improve search-and-rescue missions in the Mediterranean, participants in the summit said the arguments about how to accommodate the hundreds of thousands arriving in Europe were much more difficult.

Germany and Sweden are dealing with almost half – 45% – of all asylum claims in the EU, Merkel complained to the summit, and sought to make a small pilot scheme for sharing a few thousand immigrants binding on the 28 EU countries. She failed. The scheme is to be conducted on a voluntary basis.

Merkel’s policy is supported by those countries on the frontline of the Mediterranean’s disasters – Italy, Greece, and Malta – and by Sweden and Austria: in short, by those countries taking in most refugees in Europe.

But Berlin is strongly opposed by Britain. Last week, David Cameron pledged the Royal Navy’s flagship to the Mediterranean search-and-rescue effort but also said that migrants picked up by the British at sea would not be welcome in the UK.

Denmark, home to the EU’s most rigorous immigration regime, supports Britain, as do the countries of eastern Europe that take in minimal numbers.

The contrasts in asylum figures are striking. While Germany fielded more than 200,000 claims last year, the neighbouring Czech Republic had around 1,000. While Sweden considered more than 80,000 asylum applications, next-door Finland dealt with 3,600. Italy grappled with more than 64,000 seeking asylum while on the other side of the Adriatic, Croatia had 450 asylum-seekers.

In a European parliament debate on immigration on Wednesday, Juncker was unusually critical of last week’s summit. He described its response as inadequate. “I will work to set up a quota system,” he said. “This has to be done. It cannot wait.”

Europe, he added, had to leave its doors slightly ajar for the migrants arriving from the Middle East and sub-Saharan Africa. If the doors were closed, the immigrants would enter through Europe’s windows.


The most painful issues being fought over by EU leaders concern the relocation and resettlement of refugees. Separately from the hundreds of thousands arriving in the EU dealt with by national authorities, the commission in Brussels asked last week’s summit to bless an experiment in “burden-sharing” by agreeing to accept 5,000 immigrants between them. The 5,000 would be people fleeing war zones who had not made the perilous Mediterranean crossing and whom international refugee agencies had deemed to require protection.

Some national leaders at the summit wanted the figure raised to 10,000, while Merkel and Juncker pressed for the scheme to be obligatory. In the end, no figure was mentioned and the pilot scheme was left voluntary.

More contentious still was the debate over relocation, or moving refugees from one EU country to another. Germany and Italy support a redistribution key, but Berlin is furious that the Italian government, swamped by arrivals in the south, has been refusing to register and fingerprint migrants, meaning that they can travel on within the EU’s passport-free Schengen area to other countries, often Germany.

Merkel wants immigrants to be shared based on an EU country’s size and its relative wealth, as well as possibly factoring in unemployment rates and the size of ethnic minority communities.

German MEPs from Merkel’s Christian Democratic party lined up in the European parliament on Wednesday to call for a new quotas system while the leadership of the European People’s Party, grouping christian democrats from across the EU, agreed a policy paper last week backing the Merkel position.

Senior sources in Brussels said the summit represented a setback for Merkel’s policy, but also that events in the Mediterranean had shifted the terms of the argument in her favour.

Some national leaders wanted the reference to “relocation” dropped from the summit statement altogether. But the meeting agreed to “consider options for organising emergency relocation between all member states on a voluntary basis” as well as calling for “a more systemic and geographically comprehensive approach to migration”.
The Guardian (http://www.theguardian.com/world/2015/apr/29/germany-quota-system-eu-migrant-distribution) 29.4.2015

Lainaus
Europe, he [Juncker] added, had to leave its doors slightly ajar for the migrants arriving from the Middle East and sub-Saharan Africa. If the doors were closed, the immigrants would enter through Europe’s windows.

Ovet ovat jo auki kaikille, jos työnhakijoilla on Euroopassa kaivattua osaamista. Ikkunoista tulijoiden kyvyille ei ole käyttöä kuin harmaassa taloudessa. Arvatenkin Juncker haluaa laajaan käyttöön jo aiemmin keskustellut ns. työnhakuviisumit, joiden varjolla voi tulla ja käytännössä myös jäädä Eurooppaan.

Lainaus
Merkel wants immigrants to be shared based on an EU country’s size